KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy0742Help
Entry
MGAS9429_Spy0742  CDS       T00358                                 

Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
spk00900  Terpenoid backbone biosynthesis
spk01110  Biosynthesis of secondary metabolites
spk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spk00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGAS9429_Spy0742
Enzymes [BR:spk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     MGAS9429_Spy0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red CAMSAP_CH
Motif
Other DBs
NCBI-ProteinID: ABF31930
UniProt: Q1JM82
Position
complement(727206..728483)
Genome map
AA seq 425 aa AA seqDB search
MTKTNLNWSGFSKKTFEERLQLIEKFKLLNAENLNQLKTDVLLPIQTANQMTENVLGRLA
LPFSIAPDFLVNGSTYQMPFVTEEPSVVAAASFAAKLIKRSGGFKAQTLNRQMIGQIVLY
DIDQIDNAKAAILHKTKKLIALANKAYPSIVKRGGGARTIHLEEKGEFLIFYLTVDTQEA
MGANMVNTMMEALVPDLTRLSKGHCLMAILSNYATESLVTTSCEIPVRLLDRDKTKSLQL
AQKIELASRLAQVDPYRATTHNKGIFNGIDAVVIATGNDWRAIEAGAHAYASRNGSYQGL
SQWHFDQDKQVLLGRMTLPMPIASKGGSIGLNPTVSIAHDLLNQPDAKTLAQLIASVGLA
QNFAALKALTSSGIQAGHMKLHAKSLALLAGATQDEIAPLVNALLADKPINLEKAHFYLS
QLRQS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaactaatcttaactggagcggtttttcaaagaaaacattcgaagaacgcctc
caacttatcgaaaaatttaaactacttaatgctgaaaacttaaatcaactcaaaacagac
gttcttttgcctatccaaacagctaatcaaatgactgaaaatgtcttaggacgattggct
ttgccctttagcatagctcctgattttcttgtcaacggttcaacttatcagatgcctttt
gtcacggaagaaccttctgttgttgctgcagcatctttcgcagcaaaactaatcaaacgc
tcaggtggttttaaagctcaaaccctaaaccgacaaatgattggtcaaattgttctttac
gatatcgaccaaatagataacgctaaagccgccatccttcataaaacaaaaaagctaatt
gcattggcaaataaagcttatccttccattgttaaaagaggtggaggcgctagaaccatt
catttggaagaaaaaggagagtttttgattttctatctgactgttgatacccaagaagct
atgggagcaaatatggtcaatactatgatggaagctcttgttcctgatttaacaagactg
tctaaggggcattgtctaatggcgattttatctaattacgcaacagagtcgcttgttact
actagttgtgagattcccgtgcgccttttagatcgcgataaaacaaaatccctacagtta
gctcaaaaaatagagctagccagccgactagctcaagtagatccttaccgggctactact
cataataaaggtatttttaatggtatcgatgcagtggtaatagccacaggaaatgactgg
cgtgctattgaagcaggggcccatgcttatgcctcaagaaatggtagctatcaaggactt
agtcagtggcattttgatcaagataaacaagttctgcttggccgaatgaccctccctatg
cctattgctagtaaggggggatctatcgggcttaaccctactgtttctatcgcacatgat
cttcttaatcaacctgatgccaaaacattagcccaattgattgcatctgtggggttagct
caaaactttgctgcactaaaagctctgacctcatctggcatccaagctggtcacatgaaa
ctacatgcgaaatcattagctcttttggcgggggcaacccaagacgaaattgctccttta
gttaatgctttactagctgataaaccaataaatctagaaaaagcacatttttacttatcc
cagctaagacagtcttag

DBGET integrated database retrieval system