KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy1030Help
Entry
MGAS9429_Spy1030  CDS       T00358                                 

Gene name
fhs1
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
spk00670  One carbon pool by folate
spk01100  Metabolic pathways
spk01120  Microbial metabolism in diverse environments
spk01200  Carbon metabolism
Module
spk_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:spk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    MGAS9429_Spy1030 (fhs1)
Enzymes [BR:spk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     MGAS9429_Spy1030 (fhs1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA DUF719
Motif
Other DBs
NCBI-ProteinID: ABF32217
UniProt: Q1JLK2
Position
complement(987911..989581)
Genome map
AA seq 556 aa AA seqDB search
MKSDIEIAQSVALQPITDIVKKVGIDGDDIELYGKYKAKLSFEKMKAVEANEPGKLILVT
AINPTPAGEGKSTMSIGLADALNQMGKKTMLALREPSLGPVMGIKGGAAGGGYAQVLPME
DINLHFTGDMHAITTANNALSALIDNHLQQGNDLGIDPRRIIWKRVLDLNDRALRQVIVG
LGSPVNGVPREDGFDITVASEIMAILCLATDLKDLKKRLADIVVAYTYDRKPVYVRDLKV
EGALTLILKDAIKPNLVQTIYGTPALIHGGPFANIAHGCNSVLATSTALRLADYTVTEAG
FGADLGAEKFLNIKVPNLPKAPDAIVIVATLRALKMHGGVAKSDLAAENCEAVRLGFANL
KRHVENMRQFKVPVVVAINEFVADTEAEIATLKALCEEIKVPVELASVWANGAEGGLALA
KTVVRVIDQEAADYKRLYSDEDTLEEKVINIVTQIYGGKAVQFGPKAKTQLKQFAEFGWD
KLPVCMAKTQYSFSDNPSLLGAPTDFDITIREFVPKTGAGFIVGLTGDVMTMPGLPKVPA
AMAMDVAENGTALGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagatatcgaaattgcccaaagtgtcgccctacaaccaatcactgacattgtt
aaaaaagttggaatagacggcgatgacattgagctttatggcaaatataaggctaaattg
tcttttgagaaaatgaaagctgtcgaagctaatgagcctggaaaattaatcttggtaact
gctattaaccctactccagcaggagaaggaaaatcaaccatgtctattggactggcagat
gccttaaatcaaatgggaaaaaaaaccatgcttgccttacgtgaaccctcccttggtcct
gttatggggattaaaggcggggcagcaggtggtggttatgcccaagtattgcctatggaa
gacattaatcttcactttactggtgacatgcatgccattacaaccgctaataatgcatta
tctgctttgattgacaatcatttgcagcaaggaaacgatttaggaattgatcctcgccgc
attatttggaagcgcgtgttggaccttaatgatcgtgctcttcgtcaggtaattgttggc
ttaggcagtccagtgaatggtgtgccacgcgaagatgggtttgatatcacagtagcttct
gaaatcatggcaattttatgtttggcaactgacttgaaagatctaaagaaacgtcttgct
gatatcgtcgtggcttatacctatgatcgtaagcctgtctatgtgcgtgacttgaaggtt
gaaggagcattgacattaattctaaaagatgctatcaagccaaacttggtgcagactatt
tatggaacaccagctcttattcatggggggccatttgctaatattgctcatggttgtaat
tctgtccttgctacctcaacagctttgcgattagcagattacactgttaccgaagcagga
ttcggggccgacctaggagctgaaaaattcctaaatatcaaagtacctaatcttcctaaa
gcaccagatgctatcgtcattgttgcaaccttgcgcgcccttaaaatgcatggaggtgtc
gccaaatcagatttagccgctgaaaattgtgaggctgttcgcttaggatttgccaactta
aaacgtcacgtggaaaacatgcgccaattcaaagttccagttgtggtggctatcaatgaa
tttgtagcagataccgaggctgaaattgctaccttaaaagcgctttgtgaagagattaag
gttccagtagaattagccagtgtttgggcaaatggagctgagggaggcttagcattagct
aaaacagtggttcgtgtgattgatcaagaagctgctgactacaaacgtctctattcagat
gaggatactttggaagaaaaagtgatcaatatcgttacccagatttatggtggcaaagct
gttcaatttggccccaaggccaaaacacaattgaagcagttcgcagaattcggttgggat
aaattgcctgtttgtatggctaagacccaatacagtttttcagataacccatccttgctt
ggagcgccaaccgattttgatattaccattcgtgaatttgttcctaaaacaggggcaggt
tttattgttggtttaacaggtgatgtgatgaccatgcctggtttgcctaaagttccagct
gccatggcaatggacgtagcagaaaatggcacagccctcggtctcttttag

DBGET integrated database retrieval system