KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy1339Help
Entry
MGAS9429_Spy1339  CDS       T00358                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
spk00071  Fatty acid degradation
spk00072  Synthesis and degradation of ketone bodies
spk00280  Valine, leucine and isoleucine degradation
spk00310  Lysine degradation
spk00362  Benzoate degradation
spk00380  Tryptophan metabolism
spk00620  Pyruvate metabolism
spk00630  Glyoxylate and dicarboxylate metabolism
spk00640  Propanoate metabolism
spk00650  Butanoate metabolism
spk00900  Terpenoid backbone biosynthesis
spk01100  Metabolic pathways
spk01110  Biosynthesis of secondary metabolites
spk01120  Microbial metabolism in diverse environments
spk01130  Biosynthesis of antibiotics
spk01200  Carbon metabolism
spk01212  Fatty acid metabolism
spk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS9429_Spy1339 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    MGAS9429_Spy1339 (atoB)
   00640 Propanoate metabolism
    MGAS9429_Spy1339 (atoB)
   00650 Butanoate metabolism
    MGAS9429_Spy1339 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    MGAS9429_Spy1339 (atoB)
   00072 Synthesis and degradation of ketone bodies
    MGAS9429_Spy1339 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGAS9429_Spy1339 (atoB)
   00310 Lysine degradation
    MGAS9429_Spy1339 (atoB)
   00380 Tryptophan metabolism
    MGAS9429_Spy1339 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGAS9429_Spy1339 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MGAS9429_Spy1339 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MGAS9429_Spy1339 (atoB)
Enzymes [BR:spk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MGAS9429_Spy1339 (atoB)
Exosome [BR:spk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGAS9429_Spy1339 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: ABF32526
UniProt: Q1JKP3
Position
1306604..1307791
Genome map
AA seq 395 aa AA seqDB search
MKNIVIVEALRTPIGAFGGSFKSVSAVELGTTVLKKILDKTQVKPEMVDEVILGNVLHAG
LGQNVARQVAVHSGIPEDKTAFTLDMVCGSGLKAIQLAAQSIMLGDADIVIAGGVENMSQ
AAYVSTQHRFGQRLGNSQLIDTLVHDGLTDAFNNYHMGITAENVAQKYGISREEQDQFAL
ESQEKAARALENHRFADEIVPVSVPQRRKDPLIVTTDEYPKVDTSLEKLQQLRPAFLPKE
GTVTAGNASGINDGAALLMLMTEEKALELGLTPLVTIESYASAGVAPELMGTGPIPATQK
ALKKAGLTISDLDLVESNEAFAAQSLAVLKDLKLNPEIVNVNGGAIALGHPIGASGARIL
VTLIHEMKKRQVTRGLATLCIGGGQGTAVIVKNNT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatagttatcgttgaagctttacgaactcctatcggagcttttggaggctcc
tttaaaagtgtctctgctgttgaacttggaacaactgtactgaaaaaaatccttgataaa
acgcaagtaaagcctgaaatggttgatgaagtcatcctaggaaacgtccttcatgcaggc
ctaggacaaaatgtggcaagacaagttgcagtccactcaggaattcctgaagataaaaca
gctttcacattagacatggtttgcggttctggacttaaagcaatccaattagctgcgcaa
agcatcatgcttggtgacgctgatatcgttattgctggtggtgtcgaaaacatgtcacaa
gcagcttatgtctcaactcagcaccgctttggtcaacgtcttggtaatagtcaattgatt
gatactcttgttcatgatggcttaacagatgcttttaacaattaccacatgggtattact
gctgaaaacgttgctcagaaatatggcatctcaagagaagagcaagatcaatttgcttta
gaaagccaagaaaaagctgctagggcattagaaaatcatcgttttgctgacgaaattgtc
cctgtctctgtgcctcaacgacgcaaagatcctttaattgttacgacggatgaataccca
aaagttgacacaagccttgaaaaattacagcaattacgtcctgctttcctccctaaagaa
ggaaccgttactgctgggaatgcctcaggaataaacgatggtgcagccttattgatgtta
atgactgaagaaaaagctcttgaattagggttaacacctttagtcactattgaaagctat
gctagtgcaggtgttgcacctgaactgatgggaactggaccaattcctgccactcaaaaa
gcccttaagaaagctggattaacaatttctgatttggacttagtggagtccaatgaagca
tttgcagcacagtccttggcggttttaaaagatttaaagttaaacccagaaatcgtgaat
gttaatggaggagccatcgctttaggtcatcctattggtgccagtggcgctcgcattcta
gtcacattaatccacgaaatgaaaaaacgccaagtaaccagaggactagcaacactttgc
attggtggaggacaaggaactgctgttatcgtgaaaaacaatacttag

DBGET integrated database retrieval system