KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy1571Help
Entry
MGAS9429_Spy1571  CDS       T00358                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
spk03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MGAS9429_Spy1571 (recD)
Enzymes [BR:spk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MGAS9429_Spy1571 (recD)
DNA repair and recombination proteins [BR:spk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MGAS9429_Spy1571 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 AAA_12 UvrD-helicase T2SSE AAA_22 Herpes_Helicase HHH_5 Helicase_RecD AAA TsaE AAA_16 DUF815 NACHT UvrD_C AAA_28 DNA_pol_lambd_f Zeta_toxin DEAD AAA_14 5_3_exonuc DUF2075 NTPase_1 RsgA_GTPase AAA_18 AAA_29 AAA_5 AAA_33
Motif
Other DBs
NCBI-ProteinID: ABF32758
UniProt: Q1JK65
Position
1518612..1521065
Genome map
AA seq 817 aa AA seqDB search
MEYVFTGTVDRIIFENQANFFKILLLAIEDTDSDIDDFEIIITGTMADIIEGDDYTFWGE
LTQHPKYGQQLKLSRYQKIKPSSSGLVNYFSSDHFKGIGKKTAEKIIALYGHNTIDHILE
DPSKLETISGLSKANRQAFVAKLKLNYGTEQLIAGLVELGLSNRFAFQAFEKYKEEALDL
VKENPYQLVEDLQGFGFKMADALAENLGIESDSPKRFRAALLHCLLEESVSRGDTYVQAR
QLLDFAITLLEDARQVECDPAAVAEQLSELIIEGKIKNSDTKLFDASLYFAEEGIASNIS
RLLDTPLSQSFSHDTIQTTIQAVQKDFAITYDQVQQEAITKALTSKVFLLTGGPGTGKTT
VIRGILQAYANLHQIDLDKKDLPILLAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAMEDYLDCDLLIVDEFSMVDTWLANQLLGAINSTTQVIIVGDSDQLPSVGPGQVLSDLL
KVNSLPQIALQKIFRQSQESTIVNLADQMRRGILAADFRDKKADRSYFEAQAAFIPDMIQ
KIVLSAIKSGIPAEEIQILAPMYKGQAGINHLNQLMQELLNPLQGQTEFLFNDTHFRKGD
KVLHLVNDAQLNVFNGDIGYITDLIPAKYTESKQDELILDFDGSEVTYPRNEWLKLTLAY
AMSIHKSQGSEFQVVILPITRQSGRLLQRNVIYTAITRSKSKLILLGEYTAFEYAIKHEG
DKRQTYLIERFQEQSDLASSQPNQELKSKEQTSLFSNTATLEDDSQKSSSQSTNSNPTEN
SQSDNDDFRLTPENYSTIDSMIGLTESDIALFFQKKS
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggaatacgtttttacaggtactgttgatcgtatcatttttgaaaaccaggctaatttc
tttaaaattctcctccttgccattgaggatacagacagtgacattgacgactttgaaatc
attatcacaggaacgatggctgacattattgaaggagatgactacaccttttggggagaa
ttgacccagcaccctaaatatggacagcaactcaaactaagccgttaccaaaaaatcaaa
cctagttcatctggtttggttaattatttctctagtgaccattttaaggggattggtaaa
aaaacagcggagaaaatcattgcgctatatggtcataataccattgaccatattttagaa
gacccaagcaaattagaaactatctctggtctgtccaaggctaatcgtcaagcctttgtc
gctaaactgaaattgaattatggcacagagcaactgattgctggtctcgtcgaacttggc
cttagcaaccgttttgcctttcaagcgtttgagaagtacaaagaagaggctcttgacctt
gttaaagaaaatccctatcaattagtcgaagatctacaaggttttgggtttaagatggca
gatgctcttgctgaaaacttagggattgagagcgactctccaaaacgttttcgtgctgcc
ctcctgcactgcctcttggaagaatccgtcagtcgaggagacacttatgtccaagcacga
caattattagactttgccatcacactccttgaagatgcacgtcaagtagaatgtgatcct
gctgctgtggctgaacaactaagcgagttgatcatagagggcaaaatcaaaaacagtgac
accaaactgtttgatgctagcctttattttgctgaagaagggattgctagcaacatctct
cgtctcttagatacccctttaagtcagtcatttagtcatgataccattcaaacaaccatc
caagccgttcaaaaagactttgccatcacctatgaccaagtgcagcaagaagccattact
aaggccttaaccagcaaggtctttctcctaacaggtggtcccggaacaggaaaaacaact
gttattcgaggcattttgcaggcttacgcgaacctgcatcagattgatttggataaaaaa
gaccttcctatcttgttagcagctccaacaggtcgagctgcacgtcgcatgaatgagttg
actggacttcctagcgcaaccatccacaggcacttaggcctcaatggcgacaacgattac
caagccatggaggattatctagactgcgacctgctgattgtcgatgaattttcaatggtg
gatacctggcttgccaaccagttgttaggagcgattaactcaacaactcaagtgattatt
gtcggagatagtgaccagcttccttcggttggacccggtcaagtcctgtcagatctttta
aaagtcaatagcctgccccaaatcgccttgcaaaagatatttcgtcaatcccaagaatct
actattgtcaatttggcagatcagatgcgtcgaggaatcttagctgctgactttcgtgat
aaaaaagctgaccgttcttattttgaagcccaagcagcctttatccctgacatgattcaa
aaaattgtcctatctgctattaaaagtggcatccctgctgaggaaattcaaattttagcg
cctatgtacaaaggacaagctggcatcaatcatcttaatcaactcatgcaagaacttctc
aatcccttgcaaggacaaacagaatttctgttcaatgatacgcattttcgtaaaggtgat
aaagtcctgcacttagtcaacgatgctcagttgaatgtctttaacggagatattggttat
attacagatttgattcctgctaaatacaccgaatctaaacaagacgaattaatcttagat
tttgacggtagcgaagtcacgtaccctagaaatgaatggctaaaattaaccctggcctat
gccatgagcattcataaatcgcaagggagtgagtttcaagtggtgattttacctatcaca
cgccaaagcggccgactcttgcaacgaaatgtgatttacacggccattactcggtctaaa
agtaagttaattctgttgggagaatatactgcctttgagtatgctattaaacacgaaggc
gataaacgccaaacctacttgatcgaacgcttccaagaacaatccgacttagcctcctct
caacctaaccaagagctaaaatcaaaagagcagacctcccttttttctaatacggcaacc
cttgaggacgactctcaaaaatcttcctctcaatcaacaaactctaaccccactgagaac
tctcagtcagataatgatgattttaggttaacacctgagaattattcgactatcgattcg
atgatagggcttacagagtcagatattgccctctttttccagaaaaaatcctag

DBGET integrated database retrieval system