KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy1766Help
Entry
MGAS9429_Spy1766  CDS       T00358                                 

Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Brite
KEGG Orthology (KO) [BR:spk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spk03009]
    MGAS9429_Spy1766
Enzymes [BR:spk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     MGAS9429_Spy1766
Ribosome biogenesis [BR:spk03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    MGAS9429_Spy1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ABF32953
UniProt: Q1JJM0
Position
1715876..1716877
Genome map
AA seq 333 aa AA seqDB search
MTSVKVLKLSLLLLPPKWLSTLLKNTITGSMKTTNKPSKGFTVTLKNPFEELTVKALLEE
QLLIPRKIRHFLRTKKHVLINGHPVNWQSCVKYGDQVKLFFDHEDYPEKIIVMGQAEKVT
CLYEDEHIIIVNKPEGMKTHGNDPTELALLNHVSAYTGQTCYVVHRLDKETSGAILFAKT
PFILPILNRLLEKRDIHREYLALVHGSLDSPRVTYHHPIGRHRHDRRKRVVDPINGKKAI
TEVTLVKNFHKTASLLNCQLQTGRTHQIRVHLAHQGHVLFGDPLYSNGKKDCARLMLHAY
QLRLKHPLTREDICVQAKSATFDAVLNAQKARK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcgtgaaggtactgaagctttctctgctgctcttgccacccaaatggctatca
accttgttgaaaaataccataactggctcaatgaagacaacaaataaaccatcaaagggg
tttactgtcacactgaaaaatccctttgaagaattgacggtcaaagcattattagaggaa
caattgttaattccccgtaaaattaggcattttctgagaactaaaaaacatgttcttatt
aatggtcatcctgttaactggcaaagttgtgttaaatacggtgatcaggtcaaacttttt
ttcgatcacgaagattatcctgaaaagattatcgtgatggggcaggccgaaaaagtaacc
tgcctttatgaagatgagcacatcattattgttaacaaacctgaagggatgaaaacacac
ggcaatgatccaacagagttggcgctgctcaaccacgtgtctgcttacacgggacagacc
tgctatgtggttcatcgtctggataaggaaacaagtggggccattttatttgctaaaaca
ccttttatcttaccaatccttaatcgtcttttagaaaaaagagacatccatcgagaatat
ttggcactagttcacggatccttagacagtcctagggtaacttaccatcatccaattggt
cgtcatcgacatgaccgcagaaaacgtgttgtcgatccgataaatggcaagaaagctatt
actgaggtaactctagtcaaaaacttccacaaaacggcaagcttactcaattgtcaatta
caaactggacggactcatcaaattcgagtccatttagcccatcaaggtcatgttttattt
ggtgatcctttgtattctaatggaaaaaaagattgtgctcgactgatgctccatgcttat
caattacgtttgaaacaccctctaacccgagaagacatttgcgtgcaagctaaatcagct
acatttgacgcagtcttaaacgctcaaaaggctaggaaataa

DBGET integrated database retrieval system