KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy1864Help
Entry
MGAS9429_Spy1864  CDS       T00358                                 

Gene name
hasC
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
spk00040  Pentose and glucuronate interconversions
spk00052  Galactose metabolism
spk00500  Starch and sucrose metabolism
spk00520  Amino sugar and nucleotide sugar metabolism
spk01100  Metabolic pathways
spk01130  Biosynthesis of antibiotics
Module
spk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MGAS9429_Spy1864 (hasC)
   00052 Galactose metabolism
    MGAS9429_Spy1864 (hasC)
   00500 Starch and sucrose metabolism
    MGAS9429_Spy1864 (hasC)
   00520 Amino sugar and nucleotide sugar metabolism
    MGAS9429_Spy1864 (hasC)
Enzymes [BR:spk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MGAS9429_Spy1864 (hasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Pep_M12B_propep
Motif
Other DBs
NCBI-ProteinID: ABF33051
UniProt: Q1JJC2
Position
1819305..1820219
Genome map
AA seq 304 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKA
KRSIEDHFDSNFELEYNLQAKGKNELLKLVDETTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNASAKPLTKQLMEDYDKTHASTIAVMKVPHEDVSSYGVIAPQG
KAVKGLYSVDTFVEKPQPEDAPSDLAIIGRYLLTPEIFGILERQTPGAGNEVQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDLKNYIIKLGKALEKSKVP
THSK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcagaaaagccattattcctgctgcaggtctaggaacacgttttttacct
gctaccaaagctcttgccaaagagatgttgcccatcgttgataaaccaaccatccagttt
atcgtcgaagaagcgctaaaatctggcatcgaggaaatccttgtggtgaccggaaaagct
aaacgctctatcgaggaccattttgattcaaactttgaattagaatacaacctccaagct
aaggggaaaaatgaactgttgaaattagtggatgaaaccactgccattaaccttcatttt
atccgtcaaagccacccaagagggctgggagatgctgtcttacaagccaaagcctttgtg
ggcaatgaaccctttgtggtcatgcttggagatgacttaatggacattacaaatgcatcc
gctaaacctctcaccaaacaactcatggaggactatgacaagacgcatgcatccactatc
gctgtgatgaaagttcctcatgaagatgtgtctagctatggggttatcgctcctcaaggc
aaggctgtcaagggcctttacagtgtagacacctttgttgaaaaaccacaaccagaagat
gcgcctagtgatttggctattattggtcgttacctcctaacccctgaaatttttggtatt
ttggaaagacagacccctggagcaggtaacgaagtgcaactcacagatgctatcgatacc
ctcaataaaactcagcgtgtctttgcacgagaatttaaaggcaatcgttacgatgttggg
gataaatttggattcatgaaaacatctatcgactatgccttagaacacccacaggtcaaa
gaggacttgaaaaattacattatcaaactaggaaaagctttggaaaaaagtaaagtacca
acacattcaaagtaa

DBGET integrated database retrieval system