KEGG   Sphingomonas sp. KC8: KC8_00885Help
Entry
KC8_00885         CDS       T04987                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spkc  Sphingomonas sp. KC8
Pathway
spkc00071  Fatty acid degradation
spkc00072  Synthesis and degradation of ketone bodies
spkc00280  Valine, leucine and isoleucine degradation
spkc00310  Lysine degradation
spkc00362  Benzoate degradation
spkc00380  Tryptophan metabolism
spkc00620  Pyruvate metabolism
spkc00630  Glyoxylate and dicarboxylate metabolism
spkc00640  Propanoate metabolism
spkc00650  Butanoate metabolism
spkc00900  Terpenoid backbone biosynthesis
spkc01100  Metabolic pathways
spkc01110  Biosynthesis of secondary metabolites
spkc01120  Microbial metabolism in diverse environments
spkc01130  Biosynthesis of antibiotics
spkc01200  Carbon metabolism
spkc01212  Fatty acid metabolism
spkc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spkc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KC8_00885
   00630 Glyoxylate and dicarboxylate metabolism
    KC8_00885
   00640 Propanoate metabolism
    KC8_00885
   00650 Butanoate metabolism
    KC8_00885
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KC8_00885
   00072 Synthesis and degradation of ketone bodies
    KC8_00885
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KC8_00885
   00310 Lysine degradation
    KC8_00885
   00380 Tryptophan metabolism
    KC8_00885
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KC8_00885
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KC8_00885
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KC8_00885
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spkc04147]
    KC8_00885
Enzymes [BR:spkc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KC8_00885
Exosome [BR:spkc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KC8_00885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ARS25850
UniProt: A0A1X9YAK6
Position
complement(175237..176409)
Genome map
AA seq 390 aa AA seqDB search
MTDVVITAAKRTAVGSFLGAFANTPAHELGRVAIEAALAQAGVDAADVDEVILGQVLAAG
QGQNPARQAAVNAGVPVEKTAIGINQLCGSGLRAVALAAQAIRLGDATIVVAGGQENMSM
APHAQHLRAGAKMGSVTLVDTMIHDGLTDAFNNYHMGVTAENLAEKYQVTRAEQDAFAVR
SQNRAEKARAAGRFQDEIAPVTIKGRKGDTVIDQDEYIRAGATLEAMQALKPAFKKDGTV
TAANASGINDGAAAIVVMSADEAARRGSKVLAKIVSWATCGVDPSIMGIGPAPASRMALE
KAGWTLADVDLIEANEAFAAQSLSVGKELGWDSDKVNVNGGAIAIGHPIGASGARVLTTL
LYEMEKRDARKGLVTLCIGGGMGIAMCVER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtcgtcatcaccgccgccaaacgcaccgccgtgggcagttttctcggcgcg
tttgccaacacccccgcgcacgaactgggccgcgtcgcgatcgaagccgcccttgcacag
gccggggtggacgccgccgatgtcgatgaggtgattctcggccaggtcctcgccgccggt
cagggccagaatccggcgcgccaggcggccgtcaacgcgggcgttccggtggaaaaaacc
gcgatcggcatcaatcagctgtgcggttccggcctgcgcgccgtggcgctcgcggcacag
gcgattcgccttggcgatgccacgatcgtcgtggccggcggccaggaaaacatgtcgatg
gccccgcatgcccagcatctgcgcgctggcgccaagatgggttcggtcaccctggtcgac
acgatgatccatgacggcctgaccgacgcgttcaacaattatcatatgggcgtcaccgct
gaaaatctggctgaaaaatatcaggttacgcgcgccgaacaggatgcgttcgccgtccgc
agccagaatcgcgccgaaaaggcccgcgccgcaggccgcttccaggacgaaatcgccccg
gtaaccatcaagggccgcaagggcgacacggtcatcgatcaggatgaatatatccgcgcc
ggcgcgacgctggaagcgatgcaggcgctgaagcccgccttcaagaaggacggcaccgtc
accgccgccaacgccagcggcatcaatgatggcgccgccgcaatcgtcgtgatgtcggca
gacgaagccgcccggcgtggcagcaaggtgctggccaagatcgtatcgtgggccacgtgc
ggcgtcgatccgtcgatcatgggcatcggccctgcgcccgccagccgcatggcgctggaa
aaggcaggctggacgctggccgacgtcgatctgatcgaagcgaatgaagcgttcgccgcc
cagtctctttcggttggcaaggaacttggctgggattcggacaaggtcaacgtcaatggc
ggcgcgatcgcgatcggccatccgatcggcgccagcggcgcgcgcgtcttgaccacgttg
ctctatgaaatggaaaagcgcgacgcccgcaaaggcctcgtcaccctgtgcatcggcggc
ggcatgggcatcgccatgtgcgtcgaacggtaa

DBGET integrated database retrieval system