KEGG   Sphingomonas sp. KC8: KC8_07210Help
Entry
KC8_07210         CDS       T04987                                 

Definition
(GenBank) group 1 glycosyl transferase
Organism
spkc  Sphingomonas sp. KC8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_2
Motif
Other DBs
NCBI-ProteinID: ARS27077
UniProt: A0A1X9YE59
Position
1515776..1516954
Genome map
AA seq 392 aa AA seqDB search
MQVEDLRVALFTGNYNYVRDGANQALNRLVGYLLGQGAAVRIYSPCIDTPAFPPTGDLVG
VPALPLPGRAEYRAPLMIPPSVKRDIRAFQPNLFHVASPEILGHRAVTLGRKQGLPVVAS
VHTRFETYPRYYGLTFLEPILEAALRRFYRRCDAIFAPSESMAQLLREQRMNYDVGIWSR
GVERDIFSPAARDLAWRRGYGIGDDETVVGFVGRLVMEKGLDVFSDAIDKLEQRGVKHRV
LVVGEGPARDWFERRLPNAVFVGFQKGHDLGRAVASCDMLFNPSVTETFGNVTLEAMAAG
LPVVAAIATGSQSLVEDNVTGRLVRPGAIAQFADALQHFCENKDARAAAGAAGRVASERF
GWDAVNQVLVDAYLRVIRQRAEHREPPAQRPR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttgaagaccttcgtgtcgccctgttcacgggtaactataattacgtccgcgac
ggcgccaatcaggcgctgaaccggctggtcgggtatctgctcggccagggggccgccgtg
cggatctattcgccgtgtatcgatactccggcattcccgcccaccggcgacctggtgggc
gttcccgcattgccgttgccgggccgtgcggaatatcgcgccccgctgatgatcccgcct
tcggtaaagcgcgatatccgggcttttcagcccaatctgtttcatgtcgccagccccgaa
atccttggtcatcgggcagtcaccctggggcgcaagcaagggctgcccgtcgtggcatcg
gtccacacccggttcgaaacctatcctcgctattacggcctgaccttcctcgaaccgatc
ctggaagcggcgctgcgccgcttctatcggcgctgcgatgcgatcttcgcgccatccgaa
tcgatggcgcagctgctgcgcgaacagcggatgaactatgatgtcggcatctggtcgcgc
ggggtggaacgcgacatcttttccccggccgcacgcgatctggcgtggcggcgcggctat
ggcatcggcgacgatgaaaccgtggtcggctttgtcggccggctggtgatggaaaagggg
ctggatgtcttttccgatgcgatcgacaagctcgaacaacgcggcgtaaagcatcgtgtg
ctggtggtgggcgaagggccggcgcgcgactggttcgaacggcgcctgcccaatgccgtg
tttgtcgggttccagaagggccatgatctcggccgtgctgtcgcgtcctgcgatatgctg
ttcaatccgtcggttaccgaaaccttcggcaacgtcaccttggaagcgatggccgccggc
ctgccagtcgtcgccgcgatcgccacgggcagccagagccttgtcgaagacaatgtcacc
ggccggctggtccgccccggcgcgatcgcccagttcgccgatgcgctccagcatttttgc
gagaacaaagacgcccgcgccgccgccggtgccgccggccgtgtcgccagcgaacggttc
ggctgggatgccgtcaaccaggtgctagtggatgcctatctccgcgtcatccgccagcgc
gccgaacatcgcgagccgccagcccagcgcccccgctga

DBGET integrated database retrieval system