KEGG   Sphingomonas sp. KC8: KC8_08215Help
Entry
KC8_08215         CDS       T04987                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
spkc  Sphingomonas sp. KC8
Pathway
spkc00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:spkc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KC8_08215
Enzymes [BR:spkc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     KC8_08215
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     KC8_08215
    1.1.1.-  
     KC8_08215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: ARS27274
UniProt: A0A1X9YES2
Position
complement(1722024..1723058)
Genome map
AA seq 344 aa AA seqDB search
MKAANYVDPGKIEMRADATRPTPAPGEVLVAVEACGICGSDLHMYRNDSYRDRLARKTPE
GYEVPGHEFAGRIAELGEGVSGWTVGEKVVGVTGFGGGMSEYVTVPVNPYQLVRMPDGVS
FIEAATTEPMADGLQMVRKAAIREAENIVVFGVGIIGLGVIQAIRAQGIPAGRIVAIDVQ
QARLDKALEIGATDVVNARDGDVFAAVAAICGTEEGYRGISANVPVIFDCAGYIAHMAGP
PPLETALRLVSLQGGRIICFGGFEGAMTIDMGPIIQKEPVIMGSNGYAPEELVQALELMR
AGAVDRQTLISHRFPLDDISEAFETQCRPDAVKVVLDIREGAAA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgccaattatgtcgatcccggcaagatcgagatgcgcgcggacgcgacgcga
ccaaccccggcacccggcgaagtgctggtcgccgtcgaagcctgcggcatctgcgggtcg
gacctgcacatgtatcgcaacgacagctaccgcgatcgcctcgcgcgcaagacgcctgaa
ggatatgaggtgccgggccacgaatttgccgggcgcatcgccgaactgggcgagggcgtt
tcgggctggacggtgggcgaaaaggtggtcggcgtcaccggtttcggcgggggcatgtcc
gaatatgtgacggtgccggtgaacccctatcaactggtgcggatgcccgatggcgtgagc
ttcatcgaagcagcgacgaccgaaccgatggccgatggccttcagatggtgcgcaaggcg
gcgatccgcgaggctgaaaatatcgtcgtgttcggggtcggcatcatcgggctgggcgtg
atccaggcgatccgcgcgcagggaataccggccgggcggatcgtggcgatcgacgtgcag
caggcgcggctggacaaggcgctggagatcggcgcgaccgacgtggtgaacgcgcgtgat
ggggatgtgttcgccgccgtcgcggcgatctgcggcaccgaggaagggtatcgggggatt
tccgccaacgtgccggtgatcttcgattgcgcgggctatattgcgcacatggccgggccg
ccgccgctggaaaccgcgctcaggctggtatcgttgcagggcgggcggatcatctgtttc
ggcgggttcgaaggcgcgatgacgatcgacatggggccgatcatccagaaggaaccggtg
atcatgggttccaacggctatgcacccgaggaactggtgcaggcgctggaattgatgcgg
gccggggcggtcgatcgccagacgctgatctcgcaccgtttcccgctggatgacatatcc
gaggcgttcgaaacgcagtgccggccggatgccgtgaaggtggtgctcgacattcgcgaa
ggcgcagcggcatga

DBGET integrated database retrieval system