KEGG   Sphingomonas sp. KC8: KC8_17825Help
Entry
KC8_17825         CDS       T04987                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
spkc  Sphingomonas sp. KC8
Pathway
spkc00360  Phenylalanine metabolism
spkc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spkc00790  Folate biosynthesis
spkc01100  Metabolic pathways
spkc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spkc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    KC8_17825
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KC8_17825
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KC8_17825
Enzymes [BR:spkc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     KC8_17825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ARS29133
UniProt: A0A1X9YJW7
Position
complement(3679317..3680180)
Genome map
AA seq 287 aa AA seqDB search
MEITLDRPPEGAAADWTIDQNWDRFTAQEHAVWDTLFERQAKLLPGRASRAWLRGLDVLR
LSRPGIPDFRELSDRLMAATGWQVVAVPGLVPDAVFFDHLANRRFVAGNFIRRADQLDYL
QEPDVFHDVFGHVPMLADPVFADYMQAYGQGGLRSLDFGALHKLARLYWYTVEFGLVRED
GDLRIYGSGIVSSHGESLFALDDPSPNRIGFDLRRVMRTRYRIDDYQQSYFVIPSFEELL
HRTLETDFAPLYAELEGLDDLDPETVLADDRVITRGTQAYALAKRRI
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcacgctggatcgcccgccggagggtgccgccgccgactggacgattgatcag
aactgggatcgcttcaccgcgcaggaacatgcggtgtgggacacgctgttcgagcgtcag
gcaaaattgttgccgggccgggcttcgcgcgcatggctgcggggattggatgtgcttcgc
ctgtcgcgcccgggcattcccgattttcgggaattgtccgaccggctgatggcagcgacc
ggctggcaggttgtcgcggtgccggggctggtgcccgatgcggtgttcttcgaccatctg
gccaatcgccgcttcgtcgccggcaatttcatccgccgggccgatcaactcgattatctg
caggaacccgacgtctttcacgacgtgttcggccatgtgccgatgctcgccgatccggtg
ttcgccgattatatgcaggcgtacggccagggcgggttgcgctcgctggattttggcgcg
ctgcacaagctggcgcggttatactggtacacggtggaattcgggctggtacgcgaggat
ggcgatctgcgcatctacggatcgggaatcgtgtccagccacggcgaaagcctgtttgcg
ctggatgatcccagccccaaccgcatcggtttcgatctcagacgcgtgatgcgcacgcgc
taccggatcgacgattatcaacagagctatttcgtcatcccgagcttcgaggaactgctc
caccgcacgctcgaaacggacttcgccccgctctacgcggaactggaggggctggacgat
ctcgaccctgaaaccgtgctggcggatgacagggtgatcacccgcggcacgcaggcctat
gcgctggcaaaacgccggatctag

DBGET integrated database retrieval system