KEGG   Sphingomonas sp. KC8: KC8_18850Help
Entry
KC8_18850         CDS       T04987                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
spkc  Sphingomonas sp. KC8
Pathway
spkc00270  Cysteine and methionine metabolism
spkc00480  Glutathione metabolism
spkc01100  Metabolic pathways
Module
spkc_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:spkc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    KC8_18850
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KC8_18850
Enzymes [BR:spkc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     KC8_18850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD Dimerisation GSP_synth
Motif
Other DBs
NCBI-ProteinID: ARS29333
UniProt: A0A1X9YKJ7
Position
complement(3879824..3880777)
Genome map
AA seq 317 aa AA seqDB search
MSLKVAVQMDPLETINIAGDSTFAIMLTAQARGHQLFHYQAGDLSYRDGRVTAPARPVTV
QRVAGDHFTAGDPVVIDLADDVDVVLMRQDPPFDLAYITATHLLERIRDRTLVVNDPESV
RNAPEKLFVLDYAQFMPPTLITRRLEDARAFHAEHGEVVVKPLYGNAGSAVFHVGRNDAN
LAALTELFGQVWREPFMVQAFLPDVSKGDKRIVLIDGKPTGGINRLPKDGEIRSNLAAGG
RADPTELTAREMEICAAIGPELAKRGLLFVGIDVIAGHLTEINVTSPTGIVAIDRFNDTD
TPAIIWDVIEAKVAARG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttaaagtcgcggtccagatggatccgctcgaaaccatcaacatcgccggcgat
tccacattcgcgatcatgctgacggcgcaggcgcgcgggcaccagctattccattatcag
gctggcgacctcagctatcgcgacggccgcgtcacggcacccgcgcgcccggtgacggtg
cagcgtgtggccggcgatcatttcaccgccggcgatccggtggtgatcgatctggccgat
gatgtggatgtcgtgctgatgcggcaggatccgccgttcgatctggcctacatcaccgcg
acccatctgctcgaacgcatccgcgatcggacgttggtggtgaacgatccggaatcggtg
cgtaacgcgcccgaaaagctgttcgtgctggattatgcccagttcatgccgccgaccttg
atcacgcgccggctggaagatgcccgcgccttccacgccgaacatggcgaagtggtggtg
aagccgctttacggcaatgcggggtcggccgtgttccatgtcggccgcaacgatgcgaac
ctggccgcgctgaccgaattgttcgggcaggtgtggcgcgaaccgttcatggtgcaggcg
ttcctgcccgacgtatcgaagggcgacaaacgcatcgtcctgatcgacggcaagccgacg
ggcgggatcaaccggctgcccaaggatggcgagattcgttccaaccttgccgccgggggc
cgcgccgatccgaccgaactaacggctcgcgaaatggaaatctgcgccgcgatcggcccg
gaactggcgaaacgcgggctgttgttcgtcggtattgacgtgatcgccgggcatctgacg
gaaatcaacgtcacttcgcccaccggcatcgtcgcgatcgaccgtttcaacgacaccgat
accccggcgatcatctgggatgtgatcgaagcgaaagtcgccgcccgtgggtga

DBGET integrated database retrieval system