KEGG   Shewanella pealeana: Spea_0094Help
Entry
Spea_0094         CDS       T00606                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
spl  Shewanella pealeana
Pathway
spl00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Spea_0094
Enzymes [BR:spl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Spea_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Esterase DUF915 Abhydrolase_5 Peptidase_S28 Lipase_3 PGAP1 LIDHydrolase Thioesterase
Motif
Other DBs
NCBI-ProteinID: ABV85423
UniProt: A8GYN6
Position
complement(103963..104937)
Genome map
AA seq 324 aa AA seqDB search
MSIATEPYMNTNTAVSFSSEHHLNSPEQKVFWQQVTQSSFKTRDDISLAYARITHPNSIG
TIVISSGRVESYLKYKELMFDLYQQGYSLFAIDHRGQGLSARTTANPHQGHIDKFQRYVD
DFAEFVTKIVKPHAMENYYLVGHSMGGAIGTLYLSQYPATFKAAVFSAPMYGIKLPLPKA
FIRGLASLLDSSKQPNYILGGKGYHAEPFEKNDLTHSKLRYDDYRELYRQQPQLQLGSPT
NHWLVESIDAAEQAVDAARNSTIPLLILQAEEDTIVANAAQNRAVNGQCRLIKIPYARHE
IFMERDKPRNLALNALCEFLKQIN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgctaccgagccctatatgaacaccaatactgctgttagcttttcatcagaa
catcatctcaacagtcctgaacaaaaggtgttttggcagcaagtgacgcaatcgagcttc
aagactcgtgatgacattagcttagcctacgcccgtatcactcatccaaatagtattggc
accatagtgatcagcagtgggcgagtcgaatcctatctaaaatacaaagaactgatgttt
gacctgtatcagcaaggctacagcttgtttgccatcgatcatcgtggccaagggttatcg
gcacgcacaaccgctaatcctcatcagggacatatcgacaagttccagcgatatgtcgac
gacttcgccgaatttgtcacgaaaatagtcaaaccgcatgcaatggaaaactactaccta
gttggccattcaatggggggcgcaatcggtacgctctatctaagtcagtacccggcaacc
tttaaggccgcggtgttttcggcgcctatgtatggcatcaagctaccccttcccaaagcc
tttatccgcggcctagcgtctttactcgatagcagcaaacagcctaactatatattgggt
ggcaaaggctaccatgcagagccgttcgagaagaacgacctgacccacagcaagctgcgc
tatgacgattatcgcgagctataccgccagcagccacagctgcagctaggttcgccaacc
aaccattggttagtcgagtccatcgatgctgccgagcaggcggtagatgccgctcgaaat
agtactatcccgctgctaatcttgcaggcagaagaagatactatcgtcgctaatgccgcg
cagaatcgcgccgtaaacggccagtgccgcttaattaaaatcccctatgcccgtcatgag
atctttatggagcgagacaagccgcgcaaccttgcgctcaacgcattatgcgagttctta
aagcaaattaactaa

DBGET integrated database retrieval system