KEGG   Shewanella pealeana: Spea_0517
Entry
Spea_0517         CDS       T00606                                 

Definition
(GenBank) Monosaccharide-transporting ATPase
  KO
K10439  ribose transport system substrate-binding protein
Organism
spl  Shewanella pealeana
Pathway
spl02010  ABC transporters
spl02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:spl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Spea_0517
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Spea_0517
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spl02000]
    Spea_0517
Transporters [BR:spl02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Spea_0517
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 Peripla_BP_6 PucR
Other DBs
NCBI-ProteinID: ABV85845
UniProt: A8GZV8
Position
631445..632344
AA seq 299 aa
MKRLAHHKVSVLLSAALLSVSTSFSASAQDAIAIVLSTMNNPFFVTMKDGAEAKAAELGY
KLIALDSQNDPSKELANVEDLTMRGVKAILINPTDALAVTNAIRTANRANIPVLTLDRTA
AHGDIVSHIASDNIAGGELAGEFIAQQLGKNAKVIQLEGIAGTSAARERGEGFSNAVTAN
NFELLSSQPADFDRSKGLNVMENMLAANGDVQAVFAQNDEMALGALRAIEAAGKDILVIG
FDGTDEGIAAVRRQQLSATVAQQPELLGATAIMTADRILKGQVVEKSIPVALKIITQTQ
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaagcgacttgcccatcacaaagtgtcagttctcttgtctgcagccttgctgtcggtt
agcacgtctttcagcgccagcgcgcaagatgcgatagctatcgtgctatcgacgatgaac
aacccgttttttgtcaccatgaaagatggcgccgaggctaaagcggcagagcttggctac
aagctaatagcgctggactcgcaaaacgatcccagcaaagagctggcaaatgttgaagat
ctcaccatgcgcggcgttaaggcgattttgattaatccaaccgatgcattagcggtaacc
aatgcgattcgcaccgctaatcgtgccaacattccggtactgacattagatagaaccgca
gcacatggcgatatcgtcagccatattgcatccgacaatatcgctggtggagaacttgct
ggggagtttattgcacagcaactaggcaagaacgctaaagttattcagcttgagggcata
gccggtacatcggccgcccgtgagcgcggtgaaggttttagtaacgcagtgacggccaat
aactttgagttgttatctagccagcctgcggattttgaccgctcaaaaggcttaaacgtg
atggaaaatatgctggcagccaatggcgatgtgcaggcggtatttgcccagaatgatgag
atggcgttaggcgcactgcgcgcaattgaggcggcgggtaaagatattctggtgattggc
tttgatggcaccgatgaaggtattgcggcggttagacgtcagcaactgtcggcaacggtt
gctcagcaacctgagctattaggtgcgacggcgattatgacagcagatagaattttaaaa
ggccaagtcgttgaaaaatctatccctgttgcgttaaaaatcattactcaaacacagtaa

DBGET integrated database retrieval system