KEGG   Shewanella pealeana: Spea_1199Help
Entry
Spea_1199         CDS       T00606                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
spl  Shewanella pealeana
Pathway
spl00620  Pyruvate metabolism
spl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spea_1199
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spl02000]
    Spea_1199
Enzymes [BR:spl01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Spea_1199
Transporters [BR:spl02000]
 Other transporters
  Primary active transporters [TC:3]
   Spea_1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 PTS_EIIA_1 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABV86526
UniProt: A8H1T9
Position
1459138..1460949
Genome map
AA seq 603 aa AA seqDB search
MSKPLALTDVVLRDAHQSILATRLRTEDMLPIAPLLDKVGLWSIESWGGATFDSCIRYLG
EDPWERIRELKKVMPNTPQQMLLRGQNLLGYRHYADDLVHRFVERAHTNGVDVFRVFDAM
NDVRNLETAVKAVVEVGGHAQGTLSYTTSPVHNLTTWIYMAKRIEDMGCHSLCIKDMAGL
LKPFEAFELISQIKSQTDLVLSLHCHATTGLSTATYQKAIEAGIDVLDTAISSMSQTYGH
SATETLVAMVEGTDRATGYDMALLEEIAAYFRIIRKKYAAFEGELKGIDSRILRAQVPGG
MLTNMESQLKEQGAADKLDLVLEEIPRVREDLGFLPLVTPTSQIVGTQSVINVLTGERYK
SMTKETEGVLKGEYGATPAPVNAELQQRVLAGKEAITCRPADLLESELDKLRIELKEKAA
ADGITLAEELDDDVLTYALFPQIGLKFLSNRNNPDVFEPKPEVAAKALEEAKKAEIAAAN
KQGPETYTVTVQGQSFVVEVAEGGDISQITPSENVVPFTAPVQAAPVVDLSAVKHEQNAP
LSGNIFKVHVSPGDSVKEGDVVIILEAMKMETEVRAEADGVISKVWVKEGDAVAVGSQLL
ALA
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccattggctttaactgatgttgtcttaagagatgcacaccaatctattctc
gctactcgtttgcgtaccgaagatatgttacctattgcgccactactggataaggtgggc
ctttggtctatagagtcatggggcggtgccacttttgactcttgtattcgttatttaggt
gaagatccttgggagaggatccgtgaactcaagaaggttatgcctaatacacctcaacag
atgttattgcgcggacaaaacctcctaggttaccgtcactatgcagatgacctagtacat
cgttttgttgagcgagcccataccaatggtgtcgatgtattccgtgtcttcgatgcgatg
aacgatgtgcgcaacctagaaactgcggttaaagctgttgtcgaagtcggcggccatgct
caaggcacactatcttatactactagcccagtgcataacttgaccacttggatctatatg
gcaaagcgtatcgaagatatgggttgccattctctgtgtattaaagacatggctgggcta
ttaaagccatttgaagcatttgagcttattagccaaattaagtcgcaaaccgatctggtt
ttatctctgcactgtcatgccactacaggcctaagtacggcaacctatcaaaaagccatt
gaagctggcatcgatgtcctcgatacggctatctcttcaatgagtcagacctatggacac
agtgcaactgaaaccttggttgctatggttgaaggcactgatagagcaacgggttacgat
atggcgttgcttgaagagatcgcggcttactttagaatcatacgtaagaagtatgcggct
ttcgaaggtgagctaaaggggatcgactcacgtatcctgcgtgctcaagtgcctggtgga
atgctgactaatatggaaagccagctcaaagagcagggcgccgctgacaagttagatctt
gtacttgaggagatccctcgagtacgagaagacttaggtttcttgcctttagtcacgcca
acctcacaaatcgttggtactcagtctgttatcaacgtactaacaggtgagcgttataaa
tcaatgactaaagaaactgaaggggtattaaaaggtgaatacggtgcaacacctgcccct
gttaatgccgaacttcagcagcgtgtattggctggcaaagaagcgattacctgccgcccg
gcagacttgcttgagtctgaattagataaattgcgcatcgagttaaaagagaaagccgct
gccgatggcataacgcttgctgaagagctcgatgatgacgttctgacatacgcattattc
ccacagatcggtcttaaattccttagtaatcgtaataaccctgatgtgtttgagccaaag
cctgaggtggcggctaaagcactggaggaagctaagaaggctgagattgcagcggccaat
aagcaagggccagaaacttatactgttactgttcaaggccaaagctttgtggttgaagtc
gcagaagggggggatatcagtcagatcaccccaagcgagaatgtagtgccgtttactgca
ccagttcaagctgcgccagttgtggatctatctgcagttaagcatgagcagaatgcgccg
ctttcgggcaatatctttaaagtacacgtctcgcctggcgatagcgtcaaagagggggat
gttgtgatcattctagaagcgatgaagatggaaaccgaagttcgtgcagaggccgatggg
gtgatctcaaaggtttgggttaaagaaggtgacgctgtcgcagtgggtagtcaattgttg
gcattagcttag

DBGET integrated database retrieval system