KEGG   Shewanella pealeana: Spea_1476Help
Entry
Spea_1476         CDS       T00606                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
spl  Shewanella pealeana
Pathway
spl00860  Porphyrin and chlorophyll metabolism
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01120  Microbial metabolism in diverse environments
Module
spl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:spl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Spea_1476
Enzymes [BR:spl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Spea_1476
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Spea_1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 CysG_dimeriser Sirohm_synth_M TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABV86801
UniProt: A8H2L4
Position
1798502..1799413
Genome map
AA seq 303 aa AA seqDB search
MQYFPLFVDTHSLKVLVVGAGDVASRKLDLLSRTEASIHVIAVDICPDTLNYVKQSRITL
EQRAVSDTDIQGYDLVYLCTADKRLNERLAGIAKEQGVWANVVDNPKYCRFITPSIVDRG
RLQIAISTAGAAPVYARELRARLESWLPQSITPLFDFIAERRQEVQQRLPVFKHRRVFWE
QFFSRNDSRFDENTQSHYDASFLMQKQNGELLLIDSSTAVDLLPIGAMPYLQKIEVTYSR
LAIPFELNELLRRDASFSDCFDEATIAQQLAEGESCLVYGELDDITYLAKRFPKAKYLQA
GSF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaatattttccgctgtttgttgatacccattcacttaaggtgcttgttgttggcgcg
ggtgatgttgccagccgcaagctcgacttgcttagtcgcacagaggcgagtattcatgtc
atcgctgtcgatatttgccctgatacgctcaattatgtaaagcagagtcgtattactctt
gagcagcgagccgtgagtgacacagatattcaggggtatgatctcgtttatctctgcact
gcggataagcgccttaatgagcgcttagctggtatcgccaaagagcagggagtttgggca
aatgtggtcgataatccaaagtactgccgttttattaccccttcaatagtcgatagaggc
cgcttacagattgcgatcagtacagcgggcgcggcccctgtttatgctcgcgaactcagg
gctcgacttgaatcttggttaccacagtctataacgccgctcttcgattttattgctgag
cgtcgtcaagaggttcagcagcggttacccgtgtttaaacacagaagggtgttttgggag
cagtttttcagccgtaatgactctcggtttgatgagaatacacaaagccactatgacgcc
agttttctaatgcaaaaacagaacggtgagctgctgttaattgattcatcaaccgcagtc
gatttactccctattggcgccatgccttatctacaaaaaattgaagtaacttattcacgg
ttagccattccctttgaacttaatgagttattaagaagggatgcaagctttagtgattgt
tttgatgaggcgactatagcccagcaattagcagaaggagagtcatgcctagtgtacggt
gagcttgatgatataacttatctcgctaagcgattcccaaaggccaaatatctacaagct
ggtagcttctag

DBGET integrated database retrieval system