KEGG   Shewanella pealeana: Spea_1765Help
Entry
Spea_1765         CDS       T00606                                 

Definition
(GenBank) 37kDa nucleoid-associated protein
  KO
K06899  nucleoid-associated protein
Organism
spl  Shewanella pealeana
Brite
KEGG Orthology (KO) [BR:spl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spl03036]
    Spea_1765
Chromosome and associated proteins [BR:spl03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Spea_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NA37
Motif
Other DBs
NCBI-ProteinID: ABV87088
UniProt: A8H3F1
Position
2146033..2147061
Genome map
AA seq 342 aa AA seqDB search
MSINVEQAIIHSISQDGEGQLSCRLRPQPLLNSQAVEAMLEELHQTYTTKAGKGFGHFGI
NGEDGEANTKFEEALTTYRSGELGFVEFSGIAGKLLQEELAKYDFSTGGFLLLSCYTYMT
SDYLFVSLLNAKSSMTVLDDMELSQNTHLDLNNVQLAARIDLTEWQADPESKKYISFIRG
RAGRKVADFFLDFMGCVEGVNTKAQNKSLMNAVEDFVGNSELTKDERQQARERVFDYCTE
RCDEGASIQIKDLADELADQGMDSFYDFAQGGNYELEEEFPGDKPTLRQLKKFSGTGGGV
TLSFDGQHLGERVIYDPVSDTIIIKGVPANLKDQLDRRLKGE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagtattaacgtcgaacaagccattatccactccatttctcaagatggtgaaggtcaa
cttagttgtcgattacgtccacaacctttgctaaatagccaagcagttgaggcgatgcta
gaagagttgcatcaaacctacaccaccaaagcgggaaaagggtttggtcactttggcatt
aatggagaagatggcgaagcaaacactaagtttgaagaagcgctaactacctaccgtagt
ggtgagcttggattcgtcgagttttcgggcatagccggcaagttattacaagaggagctg
gctaaatatgactttagcactggcggcttcctattgctgtcttgctatacctacatgact
agcgattatctatttgtgtctttgctcaatgcaaaatcgtcaatgacagtactcgatgat
atggagctgtcgcaaaacactcatttagaccttaataatgtgcaattggctgcacgtatt
gatctgactgagtggcaagccgatcctgagtcgaaaaagtacatctcttttatccgtggt
cgtgcgggtcgtaaagtggccgactttttcctcgactttatgggctgtgtcgaaggtgtt
aatactaaggcgcagaataagtcgctgatgaatgcggttgaagattttgtcggtaacagt
gagctgactaaagatgagcgtcagcaagcccgtgagcgtgtattcgattattgtaccgag
cgttgcgatgaaggcgcgtcgattcagattaaagacctggccgatgagttagctgatcaa
ggcatggactctttctatgacttcgcccaagggggcaattatgagttagaagaggagttc
cctggtgataagccaacattaagacagttgaagaaattctcaggcactggcggcggggta
acattaagttttgacggtcagcaccttggtgaaagagtgatctatgatcctgtatcagat
accatcatcattaaaggtgtgcctgccaaccttaaagatcagctagatcgtcgtctgaaa
ggggaataa

DBGET integrated database retrieval system