KEGG   Shewanella pealeana: Spea_2156Help
Entry
Spea_2156         CDS       T00606                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
spl  Shewanella pealeana
Pathway
spl00071  Fatty acid degradation
spl00280  Valine, leucine and isoleucine degradation
spl00281  Geraniol degradation
spl00310  Lysine degradation
spl00360  Phenylalanine metabolism
spl00362  Benzoate degradation
spl00380  Tryptophan metabolism
spl00410  beta-Alanine metabolism
spl00627  Aminobenzoate degradation
spl00640  Propanoate metabolism
spl00650  Butanoate metabolism
spl00903  Limonene and pinene degradation
spl00930  Caprolactam degradation
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01120  Microbial metabolism in diverse environments
spl01130  Biosynthesis of antibiotics
spl01212  Fatty acid metabolism
Module
spl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Spea_2156
   00650 Butanoate metabolism
    Spea_2156
  Lipid metabolism
   00071 Fatty acid degradation
    Spea_2156
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spea_2156
   00310 Lysine degradation
    Spea_2156
   00360 Phenylalanine metabolism
    Spea_2156
   00380 Tryptophan metabolism
    Spea_2156
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Spea_2156
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Spea_2156
   00281 Geraniol degradation
    Spea_2156
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Spea_2156
   00627 Aminobenzoate degradation
    Spea_2156
   00930 Caprolactam degradation
    Spea_2156
Enzymes [BR:spl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Spea_2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABV87476
UniProt: A8H4I9
Position
2610086..2611042
Genome map
AA seq 318 aa AA seqDB search
MSNNTAHSEAAPQTTDNQLAALDVSQREDIDGVVFYEVREQVAIVTMNRPEYNNAQNSKM
TYALDAAFKRACDDDKVKVIILAGEGKHFSAGHDIGTPGRDVDQEFDRASLWYDHSNKSG
GEFLYAREQEVYLGMCRRWRDMPKPTIAMVQGACIAGGLMLAWVCDLIICSDDAYYCDPV
VRMGIPGVEYFAHVHELNSRIAKEFLFLGDKMNAQRAYELGMVNRIFSRKDLTSETLTIA
NKIAQMPRLGLQLTKQAINNAEDLMGKRSTMDMVFGLHHFAHVHNESISGDKLGGFDAKA
MAKANKAASGAEKCKETS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacaatacagctcacagtgaagcggccccgcaaactacggataaccaactagcc
gcgcttgatgtaagtcagcgcgaagatattgatggcgtcgtgttttatgaggtgcgggaa
caagttgcaattgtaaccatgaatcgccccgaatataacaatgcacaaaattcgaaaatg
acctacgcgctcgacgccgcttttaaacgagcgtgcgacgacgacaaggtaaaagtgatc
atactcgccggtgaaggtaagcacttttcagccggacatgacatcggcacccccggacgc
gacgttgaccaagagtttgatcgtgccagtctttggtacgatcacagcaataaaagcggc
ggtgagtttttatatgcgagagagcaagaggtttacttaggtatgtgtcgtcgctggcgt
gatatgccgaagccgaccattgctatggtacaaggcgcctgtatcgctggcgggctaatg
ctagcctgggtatgtgacctaattatctgttctgatgatgcctattactgcgacccagtt
gttcgaatggggatcccaggcgttgaatattttgcgcacgtgcatgagcttaactctcgc
attgcaaaagagtttttattcttaggcgacaaaatgaatgctcagcgtgcttatgagtta
ggcatggtgaaccgaattttttcgaggaaagatctcactagcgagacgttaaccatagct
aataaaatcgcccaaatgccacgacttggtttgcaactaactaagcaagcgattaataac
gcagaagatttgatgggcaaacgtagcactatggatatggtttttggcttacatcatttt
gctcatgttcataatgagtcaatatccggagacaaactcggtggctttgatgcaaaagcg
atggcaaaagccaacaaggctgccagcggtgcagagaagtgcaaggagacatcatga

DBGET integrated database retrieval system