KEGG   Shewanella pealeana: Spea_2170Help
Entry
Spea_2170         CDS       T00606                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spl  Shewanella pealeana
Pathway
spl00071  Fatty acid degradation
spl00072  Synthesis and degradation of ketone bodies
spl00280  Valine, leucine and isoleucine degradation
spl00310  Lysine degradation
spl00362  Benzoate degradation
spl00380  Tryptophan metabolism
spl00620  Pyruvate metabolism
spl00630  Glyoxylate and dicarboxylate metabolism
spl00640  Propanoate metabolism
spl00650  Butanoate metabolism
spl00900  Terpenoid backbone biosynthesis
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01120  Microbial metabolism in diverse environments
spl01130  Biosynthesis of antibiotics
spl01200  Carbon metabolism
spl01212  Fatty acid metabolism
spl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spea_2170
   00630 Glyoxylate and dicarboxylate metabolism
    Spea_2170
   00640 Propanoate metabolism
    Spea_2170
   00650 Butanoate metabolism
    Spea_2170
  Lipid metabolism
   00071 Fatty acid degradation
    Spea_2170
   00072 Synthesis and degradation of ketone bodies
    Spea_2170
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spea_2170
   00310 Lysine degradation
    Spea_2170
   00380 Tryptophan metabolism
    Spea_2170
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spea_2170
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Spea_2170
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Spea_2170
Enzymes [BR:spl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Spea_2170
Exosome [BR:spl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spea_2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: ABV87490
UniProt: A8H4K3
Position
2626720..2627925
Genome map
AA seq 401 aa AA seqDB search
MTEAVIVSVARTALSKSFRGAFNDTEAPVLGGHVVKSVVERAGIDPKSIDDVIMGAAAQQ
GTQSYNIGRLSAYTAGLPDTVSGMALDRMCASGLMSIGVAAKSIMTDEMSTVVAGGVESL
SLTQNKYKNTYRAQSQAAIAAMPSAYIQMIETAEIVAERYGISRQAQDEYSLLSQQRTAS
AQQAGYFNDEIVPITVQQLTFDENRQPAGHKETIALQDDCNRPQTTLDSLSNLAPVWKGG
EWTGEGRNVTAGNASQFADGAAASLLMSKTQAASLGIAPLGTYKGIAVAGCAPEEMGIGP
VLAIPKLLKRFGLTIDDIGLWEINEAFASQVVYCQHKLEIPADRLNVNGGAISIGHPFGM
SGARMVGHALIEGRRRGVKYVVVAMCIGGGMGAAGLFEVNQ
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagcagtgatcgtctccgttgcacgtaccgcattaagcaaatcttttcgtggc
gcatttaatgatactgaagccccggttcttggtggccatgttgtcaagtctgtcgttgag
cgtgctggtattgaccctaagtctatcgatgatgtgattatgggcgcagcagcccagcag
gggacccaatcctacaacattggcagactctcagcttataccgctggcctacccgatacc
gtatcaggcatggcactagaccgtatgtgcgcatcgggtttaatgagtattggtgttgca
gcaaaatcgattatgactgacgagatgagcaccgttgttgccggtggcgttgagtcgtta
tcgttaacccaaaataaatataagaatacttatcgagcacagtctcaagcggcaattgct
gcaatgcctagtgcttacattcaaatgatcgaaactgccgaaattgtcgcagagcgctac
ggcatcagtcgtcaggctcaagatgaatactcgctgctaagtcagcaacgcaccgctagc
gcccagcaagcgggttactttaatgatgaaattgtaccgattactgttcagcaactgacc
tttgatgaaaaccgccaaccagcaggccataaagaaacgattgcgttacaagacgattgt
aatagaccgcaaacaacgctagacagtttgtctaatcttgctcctgtttggaaaggtggc
gagtggactggcgaaggccgcaatgttaccgcgggcaatgcatcacagtttgccgatggc
gcagcggcaagtttattaatgagtaaaacccaagcagcaagccttggtattgccccctta
ggaacttacaaaggtattgccgtagcaggttgtgccccagaagagatgggaataggtccg
gtgctcgctatccccaaactgttaaagcgttttggtctgaccattgatgatataggtctg
tgggagatcaatgaagcctttgcaagccaagttgtttattgccaacacaagttagagatc
cccgccgatagattaaatgtaaatggcggcgctatttctattgggcacccatttggtatg
tctggcgctcgtatggtgggtcatgcactgattgaaggcaggcgtcgaggcgttaaatac
gttgttgtagcaatgtgtattggcggtggtatgggcgcagcaggactctttgaagtcaat
cagtaa

DBGET integrated database retrieval system