KEGG   Shewanella pealeana: Spea_2205Help
Entry
Spea_2205         CDS       T00606                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
spl  Shewanella pealeana
Pathway
spl00260  Glycine, serine and threonine metabolism
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01120  Microbial metabolism in diverse environments
spl01130  Biosynthesis of antibiotics
spl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spea_2205
Enzymes [BR:spl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Spea_2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Autoind_bind
Motif
Other DBs
NCBI-ProteinID: ABV87525
UniProt: A8H4N8
Position
2674405..2675418
Genome map
AA seq 337 aa AA seqDB search
MAGVIDLRSDTVTQPCQNMRALMASAETGDDVYGEDPSVKQLESYAAELLNKQAAVFCPS
GTQSNLMGLLSHCGRGDEYIVGNVAHTYLYEGGGAAVLGSIQPQPLTLQADATMDLSELE
KAIKPKDVHYARTKLICLENTHGGLPLPDGYTQNVKAIAQRHGLSMHLDGARLFNAVVAG
NKSAATLTADFDSVSICLSKGLGAPVGSLLVGSNKFIDEARHWRKMLGGGMRQAGIIAAA
GLYALQNNVSRLSDDHRRASELANALGQIDGVSIPLGQANTNMLYVSVSQAMRERLAERA
ANYNILLPAGEQMRLVTHLNINDDDLKAIIELFQQAA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagtaatcgatttacgcagtgataccgtcacgcagccttgccagaacatgcgc
gcgttaatggcatcagccgaaacgggtgatgatgtttatggtgaagatcctagcgttaag
cagcttgaatcctatgcagctgaattactgaataaacaagctgcggtattttgcccctca
ggcacgcaaagcaacttaatggggctgctgtctcattgtggccgaggcgatgagtacatt
gttggcaacgttgcacatacctatctttacgaaggcggcggcgccgcggtattagggagt
attcagccacagccattaacgctacaagctgatgcaaccatggatctttccgagctggaa
aaagccattaagcctaaagacgttcactatgccagaaccaagttgatatgcctggaaaac
actcatggaggtcttcctttacctgacggatacactcaaaacgttaaagcgatagcacag
cgccatggcttaagcatgcatttagatggtgctagattatttaatgccgttgttgctggt
aataagagtgctgcgacattaactgcagattttgacagtgtttcaatctgtttatcaaaa
ggcttaggagcgcctgttggctcgttactcgtaggctcaaataagtttatcgatgaagct
aggcactggcgaaaaatgttaggtggcggtatgcgccaagcaggaattattgccgctgca
ggcttgtatgccttacaaaacaacgttagtcgcttgagcgatgatcaccgccgagcgagc
gaattagcaaatgcgctagggcagattgacggtgttagtatcccgttaggtcaggccaac
accaacatgttatatgtgagcgttagccaagcaatgagagaacgccttgctgagcgtgca
gccaattacaatatattgctacctgctggtgagcagatgcgtttggtcactcacttaaat
attaatgatgatgacctaaaagccattattgagttatttcaacaagcggcttaa

DBGET integrated database retrieval system