KEGG   Shewanella pealeana: Spea_2486Help
Entry
Spea_2486         CDS       T00606                                 

Definition
(GenBank) rRNA (guanine-N(1)-)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
spl  Shewanella pealeana
Brite
KEGG Orthology (KO) [BR:spl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spl03009]
    Spea_2486
Enzymes [BR:spl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     Spea_2486
Ribosome biogenesis [BR:spl03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Spea_2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_11 Methyltransf_25 Ubie_methyltran Methyltransf_12 Methyltransf_23 Methyltransf_29 MTS Methyltransf_32 Methyltransf_9
Motif
Other DBs
NCBI-ProteinID: ABV87806
UniProt: A8H5G9
Position
complement(3031906..3032712)
Genome map
AA seq 268 aa AA seqDB search
MIYRCPLCEQALSKQDKTWCCPANHRFDCAKEGYVNLLPVQKKKSSDPGDNKEMMFARRE
FLNKGYYQVLSDKVNLLANEYLDGARSGLDIGCGEGYYSNRLVESLSPDFVLYGVDISKS
ALKYAAKRYPKIAFSVASAFDMPFPDNSFDFMLRIYAPSLDVELKRVIKPGGMLITVCAG
PRHHFALKELIYDNPKEHTQEASHIEGFELVHQERIEQLLTLSDSDDIGHFLKMTPYNWK
LTEEQKLALANSGLSCELDFKVEVFRAL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccgctgcccattatgtgaacaggctttatcaaaacaagataagacctggtgc
tgcccagcaaaccatagatttgattgtgcaaaagaagggtatgtgaatctactacctgta
cagaagaagaaatcgagcgatcccggtgacaataaagagatgatgttcgctaggcgcgag
tttctcaataaaggttattaccaggtccttagtgacaaggtcaatcttttagctaacgag
tatttagatggtgcgcgctctggcttagatattggctgcggggaaggctattattcaaat
cgcttggttgagagcttatcaccagattttgttctttatggtgtcgatatcagtaaatca
gctcttaagtatgcagcaaagcgttatccaaagatcgcttttagtgtcgccagtgccttt
gatatgccattccctgataatagtttcgactttatgttgcgtatttatgcgccgtctcta
gatgtagagcttaaacgggtgattaaaccgggcgggatgttaattacggtttgcgctggg
cctaggcatcattttgctcttaaagagttaatttatgacaacccaaaagagcacactcaa
gaagcttcacacatagagggctttgagctagttcatcaggagcggattgagcagttgtta
acacttagcgattctgacgacatcggccatttcttaaaaatgacaccttataactggaaa
ttaacagaagaacaaaaattagcattggctaattctggcttgagttgtgagttagatttt
aaagtggaagtctttagagccttataa

DBGET integrated database retrieval system