KEGG   Shewanella pealeana: Spea_2783Help
Entry
Spea_2783         CDS       T00606                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spl  Shewanella pealeana
Pathway
spl00071  Fatty acid degradation
spl00072  Synthesis and degradation of ketone bodies
spl00280  Valine, leucine and isoleucine degradation
spl00310  Lysine degradation
spl00362  Benzoate degradation
spl00380  Tryptophan metabolism
spl00620  Pyruvate metabolism
spl00630  Glyoxylate and dicarboxylate metabolism
spl00640  Propanoate metabolism
spl00650  Butanoate metabolism
spl00900  Terpenoid backbone biosynthesis
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01120  Microbial metabolism in diverse environments
spl01130  Biosynthesis of antibiotics
spl01200  Carbon metabolism
spl01212  Fatty acid metabolism
spl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spea_2783
   00630 Glyoxylate and dicarboxylate metabolism
    Spea_2783
   00640 Propanoate metabolism
    Spea_2783
   00650 Butanoate metabolism
    Spea_2783
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Spea_2783
   00072 Synthesis and degradation of ketone bodies
    Spea_2783
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spea_2783
   00310 Lysine degradation
    Spea_2783
   00380 Tryptophan metabolism
    Spea_2783
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spea_2783
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Spea_2783
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Spea_2783
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spl04147]
    Spea_2783
Enzymes [BR:spl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Spea_2783
Exosome [BR:spl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spea_2783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABV88103
UniProt: A8H6B6
Position
complement(3400507..3401697)
Genome map
AA seq 396 aa AA seqDB search
MSSVQLEQDIVIVAAKRTPMGGFQGALSSVASPKLAATAIKGLMQQSGLAGELVDEVLMG
CVLPAGLGQAPARQAALGAELPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSANVVVAGG
MESMSQAPYLLDKARGGMRMGHGKVMDHMFLDGLEDAYTGGAMGTFAQNTADDFKLTREQ
MDSFALNSLEKANAAIDSGAFSDEIAPVTVANRRGDIVVDTDEQPGNARPDKIPTLRPAF
AKDGTITAANSSSISDGAAALMLMTRGQAAELGLEVMATIKGHTTHAQEPSMFTTAPVGA
MNKLLDKVNWTKEEVDLFEINEAFAMVTMLAISELGLDASKVNVNGGACALGHPIGCSGA
RLLVTLIYALKARGLKRGVASLCIGGGEATAMAIEL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagttcagttagaacaagatattgttattgttgccgcaaagcgcacgccaatg
ggcgggtttcagggcgctctttcaagtgttgcctcaccaaagcttgctgcaacggcgatt
aaaggcttgatgcaacaaagcggtctagcaggtgagcttgtcgatgaagtcttgatgggt
tgtgtattgccagcaggcctaggccaagctccggcacgccaagcggcattaggcgctgag
ttacctctttctgttggtgcgactaccgttaacaaggtgtgtggttcaggcatgaaaacc
gtgatgctagcgcatgacttaattaaagcgggcagcgccaatgtggtggtagctggtggt
atggaaagtatgagccaagcgccttatctactagataaagctcgtggcggcatgcgtatg
gggcatggcaaagtgatggaccatatgttcctcgatggtcttgaagatgcttacacgggt
ggcgccatgggcacgttcgcgcaaaacaccgccgatgactttaagttgactcgagagcag
atggacagctttgcgctgaactctttagaaaaagccaacgccgctatcgactcgggtgcc
tttagcgatgaaatcgctccagtaacagtggcgaatcgccgcggcgatatagtggtcgat
accgatgagcagccgggtaatgcccgtccagacaaaatcccaacacttcgcccagccttt
gctaaagacggcaccatcaccgccgctaactcaagctccatctcagatggcgccgcggcg
ctgatgctaatgacacgcggccaagctgccgagctaggcctcgaagtaatggcaacaatt
aaaggtcacactacccacgcacaagagccttcaatgttcaccaccgcgccagtcggtgcg
atgaacaaactgctcgacaaagttaactggactaaagaagaggtcgacctttttgaaatc
aacgaagcctttgccatggtaactatgctggcgatttcagagcttggactcgatgctagc
aaggtcaatgttaatggcggtgcttgtgcgttaggccacccaataggctgctctggtgcg
cgcctattagtgaccttgatttatgctctaaaagcacgcggccttaagcgcggtgtagcg
tctctgtgtatcggtggcggcgaagcgacagcgatggctattgagctttaa

DBGET integrated database retrieval system