KEGG   Shewanella pealeana: Spea_3066Help
Entry
Spea_3066         CDS       T00606                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
spl  Shewanella pealeana
Pathway
spl00790  Folate biosynthesis
spl01100  Metabolic pathways
Module
spl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Spea_3066
Enzymes [BR:spl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Spea_3066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind YopE_N
Motif
Other DBs
NCBI-ProteinID: ABV88383
UniProt: A8H746
Position
complement(3761117..3761959)
Genome map
AA seq 280 aa AA seqDB search
MSILTSRHTSLDLSSPVVMGILNVTPDSFSDGGEYSSIQAACRQADLMVAQGAKIIDIGG
ESTRPGAKDVSIEDELKRVLPLIEYVSRNHDVWVSIDTSKAVVMQAAVEAGAQLINDVRA
LQEPGALSTAAKLDVPVCLMHMQGQPRTMQDAPQYDDIISDISQFFCERIEVCIDAGIKR
EQIVLDPGFGFGKSLAHNYELLNRMAEFSSFDLPVLAGLSRKSMFGQLLGREVSQRLSAT
LAGNMLAIQAGAKIVRVHDVQETSDMIAVIEAAKNFKTLA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
ttgtctattttaactagtcgtcacacatctctcgatttgagctctcccgttgtgatgggg
atcctcaatgtcacgccagattcattttctgatggtggcgaatattcatcgattcaagcg
gcttgcagacaagccgatttaatggtggctcaaggcgccaaaattatcgatattggtggt
gagtcaacccgacctggtgctaaggacgtatctattgaagatgagctaaagcgtgtgctc
cctttaattgagtatgttagtcgtaatcatgatgtgtgggtctcaattgataccagtaaa
gcggttgttatgcaggcggcagttgaagccggtgcacagctgattaatgatgttagagcg
ttacaggaacccggtgcattatctaccgcggctaagttagatgtgccggtttgtttaatg
catatgcaaggtcagccgaggaccatgcaagatgcgccacagtatgacgatatcattagt
gatattagtcagttcttctgtgagcggatcgaagtctgtattgacgcgggaattaaacgt
gagcagatagtgctcgatcctggttttggttttggtaaatcgctagcccacaattacgag
ttactcaatcggatggctgagttttcgagcttcgatttacccgtgcttgcaggtttatcg
cgtaagagtatgtttggacagttactcggacgtgaggtatcacaaagattaagtgccaca
cttgctggtaatatgctggcaatacaagcgggcgcaaagatagtgcgtgtgcatgatgta
caagagaccagtgacatgatagcagtgatagaagctgcaaagaattttaaaactttggct
taa

DBGET integrated database retrieval system