KEGG   Sphingomonas sp. LK11: AV944_05640Help
Entry
AV944_05640       CDS       T04954                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
splk  Sphingomonas sp. LK11
Pathway
splk00071  Fatty acid degradation
splk00072  Synthesis and degradation of ketone bodies
splk00280  Valine, leucine and isoleucine degradation
splk00310  Lysine degradation
splk00362  Benzoate degradation
splk00380  Tryptophan metabolism
splk00620  Pyruvate metabolism
splk00630  Glyoxylate and dicarboxylate metabolism
splk00640  Propanoate metabolism
splk00650  Butanoate metabolism
splk00900  Terpenoid backbone biosynthesis
splk01100  Metabolic pathways
splk01110  Biosynthesis of secondary metabolites
splk01120  Microbial metabolism in diverse environments
splk01130  Biosynthesis of antibiotics
splk01200  Carbon metabolism
splk01212  Fatty acid metabolism
splk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:splk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AV944_05640
   00630 Glyoxylate and dicarboxylate metabolism
    AV944_05640
   00640 Propanoate metabolism
    AV944_05640
   00650 Butanoate metabolism
    AV944_05640
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AV944_05640
   00072 Synthesis and degradation of ketone bodies
    AV944_05640
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AV944_05640
   00310 Lysine degradation
    AV944_05640
   00380 Tryptophan metabolism
    AV944_05640
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AV944_05640
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AV944_05640
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AV944_05640
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:splk04147]
    AV944_05640
Enzymes [BR:splk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AV944_05640
Exosome [BR:splk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AV944_05640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APX65412
UniProt: A0A1P8PSA0
Position
complement(1159194..1160375)
Genome map
AA seq 393 aa AA seqDB search
MTDPIVILSYARTPMGSFQGSLSGLSATQLGAAAVKGAVERAGVDAALVERIHMGCVLPA
GLGQAPARQAAIFAGLGEHVEATTVNKMCGSGMQAAIMAAEALAAGSADLIVAGGMESMT
NAPYLSHKHRGGARIGHDTLYDHMFLDGLEDAYERGRLMGHFAEEAAQEYQFTRGAQDDF
AIASLERAKAAQGAGAFDREIVAVTVKTRKGEERTTLDEQPAKGDPAKIPTLKPAFSKDG
TITAANASSISDGAAALVMTRLSVAEKLGLTPIARVVAQAGHAHAPARFTTAPVFAMRKA
LERAGWATGDADLYEVNEAFAAVAMIAMRDMDLSHDRLNVHGGACALGHPIGASGARVLA
TLLSALETKGAKRGVASLCIGGGEATAMAVELM
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcccatcgtcatcctgtcctatgcccgcacccccatgggctcgttccagggc
agcctgtcgggcctgtccgcaacccagctgggtgccgccgccgtcaagggtgcggtcgag
cgcgcgggcgtggacgccgcgcttgtcgagcgtatccatatgggctgcgtcctccccgcc
gggctgggccaggcgcccgcgcgccaggcggcgatctttgcgggccttggcgaacatgtc
gaggcgacgacggtcaacaagatgtgcgggtcgggcatgcaggccgcgatcatggcggca
gaagcactggcggcgggatcggccgatctgatcgtcgcgggcggcatggagagcatgacc
aacgccccctatctcagccacaagcatcgcggcggcgcgcggatcgggcacgacacgctc
tacgatcacatgtttctcgacgggctggaggacgcctatgagcgcggccgcctgatgggc
catttcgccgaggaagccgcgcaggaatatcagttcacgcggggcgcgcaggacgatttc
gccatcgcctcgctggaacgcgctaaggcggcgcagggcgcgggcgcgttcgaccgcgag
atcgtggcggtcacggtcaagacccgcaagggcgaggaacggaccaccctcgacgaacag
cccgccaagggcgatcccgccaagattccgacgctgaagcccgccttctccaaggacggc
acgatcacggcggcgaacgcctcgtccatttcggacggtgcggcggcgctggtgatgacg
cgcttgagtgtcgccgaaaagctgggcctgacgccgatcgcacgggtcgtggcgcaggcg
ggccacgcccatgcccccgcccgcttcaccaccgccccggtctttgcgatgcgcaaggcc
ctggagcgcgcaggctgggcaaccggcgacgccgatctctacgaagtcaacgaggcgttc
gcggcggtggcgatgatcgcgatgcgggacatggacctgtcgcacgaccggctgaacgtc
catggcggcgcctgcgcgctggggcatccgatcggtgccagcggcgcacgggtgctggcg
accctgttgtcggcgctggagacgaagggcgccaagcgcggcgtcgcgtcgctctgcatc
ggcggcggcgaagccaccgcgatggcggtggagttgatgtaa

DBGET integrated database retrieval system