KEGG   Sphingomonas sp. LK11: AV944_07070Help
Entry
AV944_07070       CDS       T04954                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
splk  Sphingomonas sp. LK11
Pathway
splk00030  Pentose phosphate pathway
splk01100  Metabolic pathways
splk01120  Microbial metabolism in diverse environments
splk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:splk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AV944_07070
Enzymes [BR:splk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     AV944_07070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_3 MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: APX67512
UniProt: A0A1P8PY87
Position
1467845..1468594
Genome map
AA seq 249 aa AA seqDB search
MVTGAESGIGAACAEAFGATGARVAILFHSDQGAADISAEAVRKAGGEAMTVQVGVDDEA
SVDQAFATVEKAWGAADVLVNSAGVNMAGVAVRDMTLAHWQRMIDTDLTGAFLTSRRFLT
GRGEAKGDATILQISSIHAYAVRAGGADYCAAKGGLTTLVETLAIEEAPRGVRVNAIEPG
MILTPMNAKAQADPAYRASLEKNIPMGRAGKASEVADLAVFLASDKARYITGARIVIDGG
LSLMQALGA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atcgtgacgggagccgagtccgggatcggcgcggcctgtgccgaggcgttcggcgcgacc
ggggccagggtcgcgatcctgttccacagcgatcagggcgccgccgacatttccgccgag
gcggtgcgcaaggcaggcggcgaggcgatgacggtgcaggtcggcgtcgatgacgaagcc
tcggtcgaccaagcctttgccaccgtcgagaaggcgtggggcgcggccgacgtgctggtc
aattccgccggggtcaacatggcgggcgttgccgtccgcgacatgacgctggcgcattgg
cagcggatgatcgacaccgacctgaccggtgccttcctgacctcgcgccgcttcctgacc
gggcggggcgaggcgaagggggatgcgacgatccttcagatttcgtcgatccacgcctat
gcggtgcgcgcgggcggtgcggattattgcgcggccaagggcgggctgaccacgctggtc
gagacgctggccatcgaggaggcaccgcgcggtgtccgggtgaacgcgatcgagccgggc
atgatcctgaccccgatgaacgccaaggcgcaggccgatccggcctatcgcgccagtctg
gagaagaacatcccgatgggccgcgcgggcaaggcgtcggaggtcgcggatctggccgtc
ttcctcgcctccgacaaggcacgctacatcaccggcgcgcgcatcgtcatcgacggcggt
ctgtcgctgatgcaggcgctcggcgcatga

DBGET integrated database retrieval system