KEGG   Sphingomonas sp. LK11: AV944_12175Help
Entry
AV944_12175       CDS       T04954                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
splk  Sphingomonas sp. LK11
Pathway
splk00480  Glutathione metabolism
splk00590  Arachidonic acid metabolism
splk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:splk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AV944_12175
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AV944_12175
Enzymes [BR:splk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AV944_12175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: APX66460
UniProt: A0A1P8PVA4
Position
complement(2649168..2649650)
Genome map
AA seq 160 aa AA seqDB search
MSGIADFTVKAADGSPIDMARYAGRVLLIVNTASKCGFTPQYEGLEALHRRFEGQGLTIL
GFPCNQFGAQEPGDAAEIANFCSLTYDVSFPVMAKIDVNGDDADPLFQWLKTEAPGVLGT
KAIKWNFTKFLVGRDGQVVGRYASTTKPEDMVKDIEGLLR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtatcgcggatttcaccgtcaaggcggcggacggctcgcccatcgacatggcg
cgctatgcggggcgcgtgctgctgatcgtcaacaccgcgtccaaatgcggcttcaccccg
caatatgaggggctggaagcgctgcatcgccgtttcgagggacaggggctgaccatattg
gggtttccgtgcaaccagttcggggcgcaggagccgggcgatgcggcggagatcgcgaat
ttctgttcgctgacctatgacgtcagctttcccgtcatggccaagatcgacgtcaatggc
gatgacgccgatccgctattccaatggctgaagacggaagcgcctggtgtgctcgggacg
aaggcgatcaagtggaacttcaccaagttcctggtcggccgggatgggcaggtggtcggg
cggtatgcgtcgacgaccaagcccgaagatatggtcaaggatatcgaagggttgcttcga
tag

DBGET integrated database retrieval system