KEGG   Sphingomonas sp. LK11: AV944_15305Help
Entry
AV944_15305       CDS       T04954                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
splk  Sphingomonas sp. LK11
Pathway
splk00270  Cysteine and methionine metabolism
splk00480  Glutathione metabolism
splk01100  Metabolic pathways
Module
splk_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:splk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AV944_15305
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AV944_15305
Enzymes [BR:splk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     AV944_15305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: APX66971
UniProt: A0A1P8PWW1
Position
3328805..3329767
Genome map
AA seq 320 aa AA seqDB search
MSQPLTVAVQMDPMDQINVAGDSTFALMLSAQARGHQLFHYDAGDLNWSDGHLWTSAHPV
TVQRVAGDHYRFGEPVKLDLGDEADVVLMRQDPPFDLGYITATHLLERVAEKTLVVNNPR
SVRNAPEKVFVLDYPQFMPPTLVTRSLDEARAFLAQHGEIVIKPLHGNGGKAIFKVGRDG
ANLSALIEVFNTAYREPHMVQAFLPAVAKGDKRIVLIDGEVAGAINRLPGEGEIRSNLAV
GGSAQKTELTEREREICAVLGPELKRRGLLFVGIDVIGGEWLTEINVTSPTGIVAIEAFD
GTDVAGLIWDAIEAKVAGRG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagccgctgaccgtcgccgtccagatggacccgatggaccagatcaatgtcgcg
ggggactcgaccttcgcgctgatgctgtcggcccaggcccgtgggcatcagctgttccac
tatgacgcgggcgatctcaactggtcggacgggcacctctggacaagtgcgcatcccgtc
accgtgcagcgcgtcgcgggcgaccattaccgcttcggcgagccggtcaagctggatttg
ggcgacgaggccgatgtcgtgctgatgcggcaggatccgcccttcgacctgggctatatc
accgccacgcatctgctggagcgggtcgccgaaaagacgctggtcgtgaacaatccgcgc
agcgtgcgcaatgcgccggaaaaggtcttcgtcctcgactatccgcagttcatgccgccg
acgctcgtcacccgttcgctggatgaggcgcgggcattcctggcgcaacatggcgagatc
gtgatcaagccgctgcacggcaatggcggcaaggcgatcttcaaggtcgggcgcgacggc
gcgaacctgtcggcgctgatcgaggtgttcaacaccgcgtaccgcgaaccacatatggtg
caggccttccttccggccgtggccaagggcgacaagcgcatcgtgttgatcgacggcgag
gtcgcgggcgcgatcaaccgcctgccgggcgagggcgagatccgctccaacctggcggtc
ggcggttcggcgcagaagaccgaattgacggagcgcgagcgcgaaatctgcgcggtgctc
ggaccggaactgaagcggcgtgggctgctgttcgtcggcatcgacgtgatcggcggcgag
tggctgaccgagatcaacgtcacctcgccgacgggcatcgtcgcgatcgaggcgttcgac
gggacggatgtcgcaggcctgatctgggacgcgatcgaagcgaaggtcgcaggtaggggc
tga

DBGET integrated database retrieval system