KEGG   Sphingomonas sp. LK11: AV944_15655Help
Entry
AV944_15655       CDS       T04954                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
splk  Sphingomonas sp. LK11
Brite
KEGG Orthology (KO) [BR:splk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AV944_15655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: APX67031
UniProt: A0A1P8PX22
Position
complement(3397884..3398282)
Genome map
AA seq 132 aa AA seqDB search
MKALFPHALTTGPVTVRVSVSYLPEQSEPQRGRWFWAYHVRIENEGDQPVQLLTRRWIIT
DARGARHSVEGEGVVGEQPVIQPGASYDYVSGCPLATTSGAMQGSYRMVGADGVTFDVAI
PHFALIAPAVET
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcgcttttcccccatgcgctgaccaccgggccggtgacggtccgcgtgtcggtc
agctatctgcccgaacagtccgagccgcagcgcgggcgctggttctgggcctatcatgtc
cgcatcgagaatgagggcgaccagccggtgcagcttctcacccggcgctggatcatcacc
gacgcgcggggtgcgcggcattcggtcgagggtgagggcgtagtcggcgaacagcctgtg
atccagccgggcgcgtcctatgactatgtctcgggttgcccgctcgcgacgaccagcggc
gcgatgcagggcagttaccgcatggtcggtgcggacggcgtgaccttcgacgtggccatc
ccgcatttcgcgctcatcgccccggcggtggagacatga

DBGET integrated database retrieval system