KEGG   Sphingomonas sp. LM7: BXU08_02560Help
Entry
BXU08_02560       CDS       T04824                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
splm  Sphingomonas sp. LM7
Pathway
splm00071  Fatty acid degradation
splm00072  Synthesis and degradation of ketone bodies
splm00280  Valine, leucine and isoleucine degradation
splm00310  Lysine degradation
splm00362  Benzoate degradation
splm00380  Tryptophan metabolism
splm00620  Pyruvate metabolism
splm00630  Glyoxylate and dicarboxylate metabolism
splm00640  Propanoate metabolism
splm00650  Butanoate metabolism
splm00900  Terpenoid backbone biosynthesis
splm01100  Metabolic pathways
splm01110  Biosynthesis of secondary metabolites
splm01120  Microbial metabolism in diverse environments
splm01130  Biosynthesis of antibiotics
splm01200  Carbon metabolism
splm01212  Fatty acid metabolism
splm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:splm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BXU08_02560
   00630 Glyoxylate and dicarboxylate metabolism
    BXU08_02560
   00640 Propanoate metabolism
    BXU08_02560
   00650 Butanoate metabolism
    BXU08_02560
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BXU08_02560
   00072 Synthesis and degradation of ketone bodies
    BXU08_02560
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BXU08_02560
   00310 Lysine degradation
    BXU08_02560
   00380 Tryptophan metabolism
    BXU08_02560
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BXU08_02560
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BXU08_02560
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BXU08_02560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:splm04147]
    BXU08_02560
Enzymes [BR:splm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BXU08_02560
Exosome [BR:splm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BXU08_02560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AQR72701
UniProt: A0A1S6FGF2
Position
complement(525773..526960)
Genome map
AA seq 395 aa AA seqDB search
MSADEIVIASYARTPMGSFQGCLADASATDLGATAVGAAVERAGLKGDAIERIYMGCVLP
AGLGQAPARQAALNAGLPNHIEATTINKMCGSGMQAAIMAAEALAAGSADFIVAGGMESM
TNAPYLSLRHRAGARIGHDVLKDHMYLDGLEDAYEPGRLMGSFAEETAQEYQFARQAQDD
FAIQSLQRAQKAQQSGAFDREIVPVEVKGRKGVTTVTLDEQPARGDIAKIPTLKPAFSKD
GTITAANASSISDGAAALVMTRASVADRLGLTPVARVVAHAAHAHAPSRFTTAPVFAMRR
ALEKAGWQIGDVDLFEVNEAFACVAMIAMHDLGISHDVLNVHGGACALGHPVGASGARVL
ATLLSALETHGQKRGLASLCIGGGEATAMAVELLD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgacgagatcgtcatcgcttcctatgcccgcacgccgatgggcagcttccag
gggtgtctggccgatgccagtgccaccgatctcggcgccaccgcagtcggcgcggcagtc
gaacgcgccgggctgaagggcgacgcgatcgagcggatctacatgggctgcgtgcttccc
gcggggcttggccaggcgcccgcgcgccaggccgcgctcaacgccgggctgccgaaccac
atcgaggcgacgacgatcaacaagatgtgcggatcgggcatgcaggcggcgatcatggcc
gccgaagcactcgccgcgggctccgccgacttcatcgtcgcgggcgggatggagagcatg
accaacgcgccctacctctcgctgcgccaccgcgccggcgcgcggatcggccatgacgtg
ctcaaggaccatatgtatctcgacgggctcgaggacgcctatgagcccggccgcctgatg
ggcagcttcgccgaggaaaccgcgcaggaatatcagttcgcccgccaggcgcaggatgat
ttcgcgatccagtcgctccagcgcgcgcaaaaggcgcagcaatcgggggcgttcgaccgc
gaaatcgtccccgtcgaagtcaagggccgcaagggcgtcaccacggtcaccctcgacgaa
cagcccgctcgcggcgacatcgcgaaaatcccgacgctcaagcctgccttctcgaaggac
ggcacgatcaccgccgccaatgcctcgtcgatctcggacggtgcggcggcgctggtgatg
acgcgcgcgagcgtcgccgatcggctcgggctcacccccgtcgcgcgtgtcgtagcgcat
gccgcgcacgcccatgcgccgtcgcggttcaccaccgctccggtctttgcgatgcgccgc
gcgctggaaaaggccggctggcagatcggcgacgtcgatctgttcgaagtcaacgaggcg
ttcgcctgcgtcgcgatgatcgcgatgcacgatctcggcatcagccacgacgtgctcaac
gtccatggcggcgcctgcgcgctcggccatccggttggcgccagcggcgcgcgcgtgctg
gcgacgttgctctcggcgctcgaaacccacggccagaagcgcggccttgcctcgctctgc
atcggcggcggcgaagccaccgcgatggcagtcgaactgctcgattga

DBGET integrated database retrieval system