KEGG   Sphingomonas sp. LM7: BXU08_04940Help
Entry
BXU08_04940       CDS       T04824                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
splm  Sphingomonas sp. LM7
Pathway
splm00450  Selenocompound metabolism
splm00970  Aminoacyl-tRNA biosynthesis
splm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:splm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BXU08_04940
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BXU08_04940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:splm01007]
    BXU08_04940
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:splm03016]
    BXU08_04940
Enzymes [BR:splm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BXU08_04940
Amino acid related enzymes [BR:splm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BXU08_04940
Transfer RNA biogenesis [BR:splm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BXU08_04940
 Prokaryotic type
   Other AARSs
    BXU08_04940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AQR73109
UniProt: A0A1S6FHI5
Position
complement(1058278..1059783)
Genome map
AA seq 501 aa AA seqDB search
MADPFYISTAIHYPNGRPHIGHAYEMIAADAIARYQRQHGRDVFFQTGTDEHGLKMVKTA
RDRGIEPRELADEMSSYFLEMADVLDISYDRFIRTSEPGHYAASQAIWQAMQDAGDLYLD
RYEGWYSVRDEAFYEEKELTEGEGGVKLSPQGTPVEWTAEETWFFKLSKYQQPLLDLYAA
NPDFIRPESRRNEILRFVEGGLVDLSVSRTSFDWGVPVPGSPDHVMYVWVDALTNYITGA
GYPDDADRFAKYWPADIHLIGKDIVRFHAVYWPAFLMSAKLPLPRQVFGHGFLLNRGEKM
SKSVGNVVDPMQLAELYGVDALRYFLLRDVSFGNDGTFSDEAIVTRANADLSNSFGNLAQ
RVLAFIAKNCDGHVPEGRSEEADAVLLAEVDVACAAFRTAFDDLALSQGVETWMTGVFAC
NQYIDAQAPWALRKTDAERMNAVLRTLLRAIHRLATTILPVIPTSAGKLLAQLPSTDDED
FRIAPPTPIFPRLELQAAEEA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcccttctatatctcgacagcaatccactatcccaatggccgcccgcatatc
ggccatgcctatgagatgatcgccgccgacgcgatcgcgcgctaccagcgccagcacggc
cgcgacgtcttcttccagaccggcaccgacgagcacggcctcaagatggtcaagaccgcg
cgcgaccgcggcatcgaaccgcgcgagctggccgacgagatgtccagctatttccttgag
atggccgacgttctcgatatttcgtacgaccgtttcatccgcacctccgaacccgggcac
tatgccgcgagccaggcgatctggcaggcgatgcaggatgccggcgacctctatctcgat
cgctacgagggctggtattcggtccgcgacgaggcgttctacgaagagaaggaactgacc
gagggggaagggggcgtgaagctctcgccgcagggcacccccgtcgagtggaccgcggag
gagacctggttcttcaagctctccaagtaccagcagcccctgctcgatctatacgccgcc
aatcccgacttcatccgcccggaatcgcgccgcaacgagatcctgcgcttcgtcgagggc
ggactggtcgatctctcggtcagccgcaccagcttcgattggggcgtgccggtgccgggc
tcccccgatcacgtgatgtacgtctgggtcgacgcgctcaccaactacatcactggcgcg
ggctatcccgacgatgccgatcgcttcgccaaatactggcccgccgacatccatctgatc
ggcaaggacatcgtccgcttccacgccgtctattggcccgccttcctgatgtcggcaaag
ctgccgctgcccaggcaggtcttcggccacggcttcctgctcaaccgcggggaaaagatg
tccaagtcggtcggtaacgtcgtcgatccgatgcagctcgccgagctctatggcgtcgat
gccttgcgctatttcctgctgcgcgacgtcagcttcggcaatgacggcacgttcagcgac
gaagcgatcgtcacccgcgccaatgccgacctgtcgaacagcttcggcaatctcgcccag
cgcgtcctcgccttcatcgccaagaattgcgacggccatgtccccgagggccggagcgaa
gaggccgacgccgtcctcctcgccgaagtggacgtcgcctgcgccgccttccgcaccgca
ttcgacgatcttgcgctcagtcagggcgtcgagacgtggatgaccggcgtgttcgcctgc
aaccaatatatcgacgcgcaggcgccctgggcgcttcggaaaaccgatgccgagcggatg
aatgccgtgctgcgtacgctgctccgcgcgatccaccgccttgccactacgatcctcccg
gtgatcccgacctcggcaggcaaattgctcgcgcaactcccctcgaccgacgacgaggac
ttccgcatcgccccgccgacccccatcttcccgcgactggaactgcaggcggcggaggaa
gcgtga

DBGET integrated database retrieval system