KEGG   Sphingomonas sp. LM7: BXU08_11150Help
Entry
BXU08_11150       CDS       T04824                                 

Definition
(GenBank) hypothetical protein
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
splm  Sphingomonas sp. LM7
Pathway
splm00230  Purine metabolism
splm00240  Pyrimidine metabolism
splm00760  Nicotinate and nicotinamide metabolism
splm01100  Metabolic pathways
splm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:splm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BXU08_11150
   00240 Pyrimidine metabolism
    BXU08_11150
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BXU08_11150
Enzymes [BR:splm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     BXU08_11150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos
Motif
Other DBs
NCBI-ProteinID: AQR74132
UniProt: A0A1S6FKH2
Position
complement(2408821..2410581)
Genome map
AA seq 586 aa AA seqDB search
MRVVVGMLAAAMLAGCAGHVAESGAAPAAKPVSVQIIAFNDFHGNLEAGKLAVDIPGEGE
TSQRIAAGGVAYIAAAVAKLREGHPNSLTVSAGDMISASPLISSMFLDEPTIHAMNLIGV
DFNAVGNHEFDRGQKELRRLQTGGCEKNTARQPCAIEPFPGASFRYLAANVATDGGGTLF
PSTGIRSFGAGKRQVRIGFIGMTLKGTGTLVMPSGVEGLRFEDEADTVNALVPRLKAQGA
DAIIVLIHQGGYSKLAFDANSCAGMTGDILPILTRLDPRVDLVVSGHTHNAYVCDYGSID
ASRPLLLTSAGYGGTLLTDISLDIDPVEGRVVAKRANNVLVQGEAFTSAKGLVGTSDRYA
RIAPDPRLTALVARYAAAVKTYADRPIGRLTAPAPRTDEQMREQVLGNLLADVQLAATAA
PEKGGAEIAFMNAGSARASLVPRADGAITFGDIYAAQPYSNTLVVKSLTGKQVLAVLEQQ
FDENKAGGRNLLLVSRGFGFGYDLGRPVGQRVIDPKLNGAPMVADRTYRVVVSNFLANGG
DGFTTLTAGTELLTGIGDLDAIEAYFARGPVTPPAIDRTRDLTLRN
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtagtggtcggaatgctggcggcggcgatgctcgcgggatgcgcagggcatgtc
gccgagtccggcgccgcgccggcggcaaagccggtgtcggtccagatcattgcgttcaac
gatttccacggcaatctcgaagccggcaagctcgcagtggacattcccggcgaaggcgaa
acgagccaacggattgctgccggcggcgtcgcctatatcgccgcggcggtggcgaagctt
cgggagggccatccgaacagcctgaccgtttccgcaggggacatgatcagcgcgagcccc
ctgatctcgtcgatgttcctcgacgagccgacgatccacgcgatgaacctgatcggagtc
gatttcaacgcggtcggcaatcacgagttcgaccgcgggcagaaggaattgcggcggctc
cagaccggcgggtgcgagaagaataccgcgcgccagccctgcgcgatcgagccgttcccg
ggcgcgtcgttccgatatctcgccgccaacgtcgccacggacggaggcggcacgctgttc
ccgagcaccggcatccgcagcttcggcgccggcaagcggcaggtccgcatcggctttatc
ggcatgacgctgaagggaacggggacgctggtgatgccgagcggcgtcgaagggctgcgc
ttcgaggacgaggcggatacggtcaatgcgctggtgcccaggctcaaggcgcagggcgcc
gacgcgatcatcgtgctgatccaccagggcggctattccaaactcgccttcgacgcgaac
agctgcgcggggatgaccggcgacatccttccgatcctcacgcggctcgatccgcgtgtt
gaccttgtcgtctcgggccacacgcacaatgcctatgtctgcgactatggcagcatcgat
gcgagccggccgctgctgctgaccagcgcgggctatggcggcacgctgctgaccgacatc
tctctggacattgatcccgtcgagggccgggtcgtcgcgaagcgggcgaacaacgttctg
gtccagggggaggcgttcaccagcgccaaggggctggtcggcaccagcgaccgttatgcg
cgtatcgcccccgatccgcggctgacggcgctggtcgcgcgctatgcggcggccgtgaag
acctatgccgaccggccgatcgggcggctgactgcgcccgcgccgcgcaccgacgaacag
atgcgcgagcaagtgctcggcaacctgctcgccgacgtccaactcgcggcgacggctgcg
ccggagaagggcggcgccgagatcgccttcatgaacgccggcagcgcccgcgcatcgctg
gtcccacgcgcggacggtgcgatcacctttggcgacatctatgccgcgcagccctattcc
aacacgctggtggtcaagagcctgaccggcaagcaggtgctcgcggtgctcgaacagcag
ttcgatgaaaacaaggcgggggggcgcaatttgctgctggtctcgcgcggtttcggcttc
ggctatgatctggggcggccggtggggcagagggtgatcgacccgaagctgaacggcgcg
ccgatggtggcggaccggacctatcgcgtggtggtcagcaatttccttgccaatggcggc
gacggattcactacgctgaccgcgggcaccgagctgctgaccggcatcggcgatctcgat
gcgatcgaggcgtatttcgcgcgcgggccggtgacgcccccggccatcgaccggacccgc
gatctgacattgcgtaattag

DBGET integrated database retrieval system