KEGG   Sphingomonas sp. LM7: BXU08_18620Help
Entry
BXU08_18620       CDS       T04824                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
splm  Sphingomonas sp. LM7
Pathway
splm03010  Ribosome
Brite
KEGG Orthology (KO) [BR:splm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BXU08_18620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:splm03011]
    BXU08_18620
Ribosome [BR:splm03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BXU08_18620
  Bacteria
    BXU08_18620
  Archaea
    BXU08_18620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AQR75394
UniProt: A0A1S6FP14
Position
3971458..3971835
Genome map
AA seq 125 aa AA seqDB search
MSKPQAPRKVGDKEALAVATQIRGSAQKLNLVAGLIRGRKVGDALNILQFSTKAMAVDAR
KVLASAIANAENNHNLDVDALVVAEASVGKSITMKRFATRGRGKSTRILKPFSRLRIVVR
EQEEA
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcctcaggcaccccgcaaggttggcgacaaggaagcgctggcagttgcgacg
cagatccgcggttcggcccagaagctgaacctcgtcgctggtctcatccgcggccgcaag
gtcggtgatgcgctgaacatccttcagttctccaccaaggcgatggccgtcgacgcacgc
aaggttctcgcgtccgcgatcgccaatgccgagaacaaccacaacctcgatgtcgacgcg
ctcgtcgtcgccgaggcttcggtcggcaagtcgatcacgatgaagcgcttcgcgacccgc
ggccgtggcaagtccacccgcatcctgaagccgttcagccgtcttcgcatcgtcgtccgc
gagcaggaagaagcataa

DBGET integrated database retrieval system