KEGG   Streptomyces pluripotens: LK06_011895Help
Entry
LK06_011895       CDS       T04845                                 

Definition
(GenBank) GDP-mannose pyrophosphorylase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
splu  Streptomyces pluripotens
Pathway
splu00051  Fructose and mannose metabolism
splu00520  Amino sugar and nucleotide sugar metabolism
splu01100  Metabolic pathways
splu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:splu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LK06_011895
   00520 Amino sugar and nucleotide sugar metabolism
    LK06_011895
Enzymes [BR:splu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     LK06_011895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Fucokinase Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ARP70544
UniProt: A0A221NY11
Position
complement(2699752..2700834)
Genome map
AA seq 360 aa AA seqDB search
MTEAILLVGGKGTRLRPLTVHTPKPMVPAAGVPFLTHQLARAKAAGVDHIVLATSYLAEV
FEPHFGDGSALGLHIEYVTEEEPLGTGGAIRNVASRLHSGPDDPVLIFNGDILTGLDIRA
LVHTHESTGADVSLHLTKVTDPRAYGLVPTDGTGRVLAFLEKPQTPEEIVTDQINAGAYV
FRRSVIDTIPVGRAVSVERETFPELLSAGAHLQGMVDSTYWLDLGTPAAFVRGSADLVLG
RAPSPAVPGRRGDRLVLPTATVAPDAKLTGGTVVGEGAFVAEGALVFGSTILPGAVIEPG
AVVTDSLVGTRARVGERSVLTGAFIGDGAIVGADNELRDGVRVWCDACIPAGAVRFSSDQ
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgacagaagcgatcctcctggtcggcggcaagggaacccggctgcgcccgctcacggtg
cacacgcccaagcccatggtcccggcggccggggtgccgttcctcacccatcagctggcg
agggcgaaagcggcgggtgtggatcacatcgtcctcgcgaccagctatctggccgaggtc
ttcgagccccacttcggtgacggctccgcgttgggcctgcacatcgagtacgtcaccgag
gaggagcccctcggcacgggcggcgcgatccgcaacgtggcctcccgtctgcactccggc
cccgacgaccccgtactgatcttcaacggtgacatcctgacgggcttggacatcagggcg
ctcgtccacacgcacgagtcgacgggcgcggacgtctccctgcacctgacgaaggtgacc
gacccgcgcgcctacggtctcgtgcccacggatggcaccggccgtgttctggctttcctg
gagaagccccagacccccgaggagatcgtcaccgaccagatcaacgcgggcgcgtacgtc
ttccggcgctcggtcatcgacacgatcccggtgggccgtgcggtgtccgtggaacgcgag
accttccctgaactcctgtcggccggtgcccacctgcagggcatggtcgactccacgtac
tggctggacctcggcacccctgcggccttcgtccgcggctcggccgacctcgtgctcggc
cgcgccccctctccggccgtccccggccgccgcggagaccggctcgtcctgcccacggcc
acggtcgccccggacgccaagctgacgggcggcaccgtggtcggtgagggcgcgttcgtg
gcggagggtgccctggtcttcggttcgaccatccttcccggagccgtcatcgaacccggc
gccgtcgtcaccgactccctcgtcggcacccgggcccgcgtcggtgaacgttccgtcctc
accggcgcgttcatcggagacggtgcgatcgtgggcgccgacaacgagctgcgcgatggc
gtacgggtgtggtgtgacgcctgcatacccgcgggggcggtgcggttctcctctgatcag
taa

DBGET integrated database retrieval system