KEGG   Streptomyces pluripotens: LK06_012260Help
Entry
LK06_012260       CDS       T04845                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
splu  Streptomyces pluripotens
Pathway
splu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:splu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LK06_012260
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:splu03011]
    LK06_012260
Ribosome [BR:splu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LK06_012260
  Bacteria
    LK06_012260
  Archaea
    LK06_012260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ARP70612
UniProt: A0A221NY99
Position
complement(2769129..2769476)
Genome map
AA seq 115 aa AA seqDB search
MEARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAH
NYDHTDVDSLVVSEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVSSKEGTR
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggaagccagggcccaggcgcggtacatccgcgtcacgcccatgaaggcccgccgtgtg
gtggacctcatccgtggcatggacgccacggaggcccaggccgtcctgcgattcgctccg
caggccgcctccgtgccggtcggcaaggtgctggacagcgccatcgccaacgccgcgcac
aactacgaccacaccgacgtcgacagcctcgtcgtttccgaggcctacgtcgacgagggc
ccgaccctgaagcggttccgtccgcgtgcccagggccgtgcctaccggatccgcaagcgg
accagccacatcaccgtggtcgtcagcagcaaggaaggaacccggtaa

DBGET integrated database retrieval system