KEGG   Streptomyces pluripotens: LK06_023930Help
Entry
LK06_023930       CDS       T04845                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
splu  Streptomyces pluripotens
Pathway
splu00250  Alanine, aspartate and glutamate metabolism
splu00330  Arginine and proline metabolism
splu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:splu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LK06_023930
   00330 Arginine and proline metabolism
    LK06_023930
Enzymes [BR:splu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     LK06_023930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh P53_TAD
Motif
Other DBs
NCBI-ProteinID: ARP72494
UniProt: A0A221P3H9
Position
5319325..5320956
Genome map
AA seq 543 aa AA seqDB search
MDAVTQVPTPVNEPVHGYAPGSPERARLEAKLKELAENPVDLPMTIGGEKRMGGGEAIQV
VQPHNHKAVLGTLRNATQQDAQDAIDAALAAAPAWRAMSFDDRAAIILRAAELLAGPWRE
TIAASTMLGQSKTAQQAEIDSPCELVDFWRFNVHYARQILAEQPPANSPGVWNRLDHRPL
EGFVYAITPFNFSAIAANLPTAPALMGNVVVWKPSPTQTHAAVLLMQLLEEAGLPKGVIN
LVTGDGIEVSEVALEHRDLAGIHFTGSTKTFQYLWKTVGNNIEKYRSYPRLVGETGGKDF
VVAHPSADRAILKTALTRGAFEYQGQKCSATSRAYIPASIWNSGFKEEFAAEVDYLTMGD
VTDLSNFMGAVIDERSFAKNKAAIDRAQQDPSCTIVAGGSYDDSVGYFVRPTVVECTDPE
NEVFTTEYFGPFLAVHVYEDDQYDEMLTQMESVSDYALTGSVIAGDRAAAAYTMDKLRFA
AGNFYINDKSTGAVVGQQPFGGGRASGTNDKAGAPQNLLRWTLTRAIKETLVPPTDYTYP
HMG
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgtgacccaggtccccacccccgtcaacgagccggtgcacggctacgccccc
ggctcgccggagcgcgcgaggctggaggccaagctcaaggagctggccgagaacccggtc
gacctgccgatgaccatcggcggtgagaagcggatgggcggcggcgaggccatccaggtg
gtgcagccgcacaaccacaaggccgtgctcggcaccctgcgcaacgccacccagcaggac
gcgcaggacgccatcgacgcggccctcgctgccgcaccggcctggcgcgcgatgtccttc
gacgaccgtgccgcgatcatcctgcgcgccgccgagctgctggccggtccgtggcgcgag
acgatcgccgcctccaccatgctcggccagtccaagaccgcccagcaggcggagatcgac
agcccctgtgagctcgtcgacttctggcgcttcaacgtccactacgcccgccagatcctc
gccgagcagcccccggcgaactccccgggtgtctggaaccgcctggaccaccgcccgctg
gagggcttcgtctacgcgatcacgccgttcaacttcagcgcgatcgccgccaacctcccc
accgcccccgccctcatgggcaacgtggtggtctggaagccgtccccgacccagacccac
gcggccgtcctgctcatgcagctgctggaggaggcgggcctgcccaagggcgtcatcaac
ctcgtcaccggcgacggcatcgaggtctccgaggtcgccctggagcaccgggacctggcc
ggcatccacttcaccggctcgaccaagaccttccagtacctgtggaagacggtcggcaac
aacatcgagaagtaccgctcctacccgcgcctggtcggtgagaccggtggcaaggacttc
gtggtcgctcacccgagcgccgaccgcgccatcctgaagaccgccctgacccgcggtgcc
ttcgagtaccagggccagaagtgcagcgcgacctcccgcgcgtacattccggcgtccatc
tggaactcgggcttcaaggaggagttcgccgccgaggtcgactacctcaccatgggtgac
gtcaccgacctgtccaacttcatgggtgcggtcatcgacgagcgttccttcgccaagaac
aaggcggccatcgaccgcgcccagcaggacccgtcctgcaccatcgtggccggcggcagt
tacgacgactcggtcggctacttcgtccgcccgaccgtcgtcgagtgcaccgacccggag
aacgaggtcttcaccaccgagtacttcggcccgttcctcgccgtgcacgtctacgaggac
gaccagtacgacgagatgctgacccagatggagtccgtctccgactacgcgctgaccggt
tcggtcatcgcgggcgaccgtgccgccgccgcgtacacgatggacaagctccgcttcgcc
gcgggcaacttctacatcaacgacaagtcgaccggtgccgtcgtcggccagcagcccttc
ggcggcggccgtgcctccggcaccaacgacaaggccggggctccccagaacctcctgcgc
tggacgctgacccgcgctatcaaggagaccctggtcccgccgaccgactacacctacccg
cacatgggctga

DBGET integrated database retrieval system