KEGG   Streptomyces pluripotens: LK06_025090Help
Entry
LK06_025090       CDS       T04845                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
splu  Streptomyces pluripotens
Pathway
splu00730  Thiamine metabolism
splu00790  Folate biosynthesis
splu01100  Metabolic pathways
splu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:splu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LK06_025090
   00790 Folate biosynthesis
    LK06_025090
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LK06_025090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:splu04147]
    LK06_025090
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:splu00537]
    LK06_025090
Enzymes [BR:splu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LK06_025090
Exosome [BR:splu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LK06_025090
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:splu00537]
 Enzymes
  LK06_025090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: ARP72687
UniProt: A0A221P404
Position
5588777..5590141
Genome map
AA seq 454 aa AA seqDB search
MLKPTRRHLMTATALVAATTAAVAVTTTAGAFDGKDRARSAIRGGKAKNVILLIGDGMGD
SEITLARDYTVGADGRLNMDRFPLTGAYTTYSVHADGTPDYVTDSAASGTGWATGVKTVN
GRISKTPGTDKPVRTILELAQRNGYATGSVTTAELTDATPAVLASHATDRSCQGPADMAK
CPKDTIAAGGPGSIAEQFVNHKVDVLFGGGRRRFDQQVTDGRYKGLTVTEQARRLGYQVV
TDDASMKAAKAGKPVLGLFATGNVPVEWTGEVAAVGGTDPQRCVTSNPDRPSGTPSLADS
AAEAIRLLAAKQRRAHSHKGFFLQIEGASIDKRDHAADPCGQIGETAAFDRAVKVARAYA
AQHPDTLVVTTADHGHTSQIVPLGANPPGLSSTLVTNEGQQLKVNYSTDTPGRSQEHTGT
EVRIAAQGPQAYRVLGVTNQTDLFTTMREALHLR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagcccacccgtcgccacctcatgaccgccaccgcactggtcgccgcgaccacg
gccgccgtggccgtcaccaccaccgccggtgcctttgacggcaaggaccgggccaggagc
gccatccggggcggcaaggcgaagaacgtcatcctgcttatcggtgacggcatgggcgac
tcggagatcaccctggcccgtgactacaccgtcggtgccgacggtcggctgaacatggac
aggttcccgctcaccggcgcgtacacgacctactcggtgcacgccgacgggacaccggac
tacgtgaccgactccgccgccagcggcaccggctgggcgacgggcgtcaagacggtcaac
ggccgcatctccaagacgccgggtaccgacaagccggtccggaccatcctggaactggcg
cagcggaacggctacgccaccggcagcgtcaccaccgccgaactcaccgacgccaccccg
gccgtgctcgcctcgcacgccaccgaccgctcctgccagggccccgcagacatggccaag
tgccccaaggacaccatcgcggccggcggacccggatcgatcgccgagcagttcgtcaac
cacaaggtcgacgtcctcttcggcggcggcaggcggcgcttcgaccagcaggtcaccgac
ggcaggtacaaggggctcaccgtcactgagcaggcacgcaggctcggctaccaggtcgtc
accgacgacgcgtcgatgaaggccgccaaggcgggcaagccggtcctcggtctcttcgcc
acgggcaacgtaccggtggagtggacgggtgaggtggcggcggtcggcggcaccgacccg
cagcggtgtgtgacctcgaacccggaccgtccttccggcacgccgagtctcgcggactcc
gccgccgaggccatccggctgctggcggcgaagcagcggcgggcccactcgcacaagggc
ttcttcctgcagatcgagggcgcatccatcgataagcgggaccacgccgcggacccgtgt
ggacagatcggggagaccgccgccttcgaccgtgcggtcaaggtcgcccgcgcctacgcc
gcccagcacccagacaccctcgtcgtcacgaccgccgaccatggccacaccagccagatc
gtcccgctgggggccaacccgcccggcctgtcctccacccttgtcaccaacgagggccag
cagctgaaggtcaactactcgaccgacaccccgggccggtcccaggaacacaccggcacc
gaggtccgcatcgccgctcagggccctcaggcgtaccgcgttctcggggtgacgaaccag
accgacctcttcacgaccatgcgtgaggcccttcacctgcgctga

DBGET integrated database retrieval system