KEGG   Streptomyces pluripotens: LK06_029985Help
Entry
LK06_029985       CDS       T04845                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
splu  Streptomyces pluripotens
Pathway
splu00471  D-Glutamine and D-glutamate metabolism
splu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:splu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LK06_029985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:splu01011]
    LK06_029985
Enzymes [BR:splu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     LK06_029985
Peptidoglycan biosynthesis and degradation proteins [BR:splu01011]
 Precursor biosynthesis
  Racemase
   LK06_029985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF498
Motif
Other DBs
NCBI-ProteinID: ARP73504
UniProt: A0A221P6P0
Position
6819560..6820345
Genome map
AA seq 261 aa AA seqDB search
MKIALMDSGIGLLPAAAAVRRLRPDADLVLSWDPDGMPWGPRTPEDITERALAVAEAAAA
HDPDVLIVACNTASVHALPVMRARFEPDLPVIGTVPAIKPAAAGGGSVAIWATPATTGSA
YQRGLIEQFADGVAVTEVPCPGLADAVHHADDDAVDAAVAAAAARTPEDVTTVVLGCTNY
ELVAERIRAAVQRPGRPPLILHGSAGAVAAQALRRIGAEPASVAAADTTLTVLLSGREEA
LPDTALAYDEGRFLHAVSPVR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcgcgctcatggactccggaatcggcctgctgcccgcagccgctgcggtacgt
cggctgcggcccgacgccgacctcgtgctctcctgggacccggacggcatgccctggggc
ccgcgcacccccgaggacatcactgagcgagccctggccgtggccgaggcggctgccgcc
cacgaccccgatgtcctgatcgtcgcctgcaacacggcgtccgtgcacgcgctgcccgtg
atgcgggcgcgtttcgagcccgacctgccggtcatcgggaccgtaccggcgatcaagccc
gctgcggctggcggcgggtccgtagcgatctgggcgacccccgccaccacaggcagcgcc
taccaacgaggactgatcgaacagttcgccgacggcgtggccgtcaccgaggtgccgtgc
ccgggtctcgcggacgcggtgcaccacgccgatgacgacgccgtcgacgccgccgtggcg
gcggccgccgcccggacgccggaggacgtgaccaccgtggtcctgggctgcaccaactac
gagctggtcgccgagcgcatccgggccgccgtccagcggccaggacgtccgccgcttatc
ctgcacggctccgccggggccgttgccgcacaggccctgcgcaggatcggagcggagccg
gcctcggtggccgcggccgacaccaccctgacggtgctgctcagcggtcgcgaggaagcg
ctcccggacacggccctcgcctacgacgagggacgtttcctgcacgccgtcagccccgtc
cgctga

DBGET integrated database retrieval system