KEGG   Serratia plymuthica PRI-2C: Q5A_006870Help
Entry
Q5A_006870        CDS       T04576                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sply  Serratia plymuthica PRI-2C
Pathway
sply00473  D-Alanine metabolism
sply00550  Peptidoglycan biosynthesis
sply01100  Metabolic pathways
sply01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sply00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Q5A_006870 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Q5A_006870 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Q5A_006870 (ddlA)
Enzymes [BR:sply01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Q5A_006870 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:sply01011]
 Precursor biosynthesis
  Amino acid ligase
   Q5A_006870 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 RimK
Motif
Other DBs
NCBI-ProteinID: ANS41843
UniProt: A0A1B1KN31
Position
1450867..1451970
Genome map
AA seq 367 aa AA seqDB search
MTKLRVGVIFGGKSAEHEVSLQSAKNIVDAIDKEKFDVTLLGIDKQGQWHINDASNYLLN
AENPALIALNRSNKNVALIPGQEKQQLIEASSAGALGQLDVVFPIVHGTLGEDGSLQGLL
RMANMPFVGAGVLGSAVSMDKDVTKRLLRDAGLAVAPFVTLTRTNRSKYDFDQLSERLGL
PLFIKPANQGSSVGVSKVQDRAGFDAALALAFSFDHKVLVESAIVGREIECAVLGNDEPQ
ASLCGEIVLSDAFYSYDTKYINEQGAQVVVPAEIAPEVSDKIRDVALKAFRALECFGLAR
VDVFLTPDNNVVINEINTLPGFTNISMYPKLWAASGVSYSKLITRLIELALERHQQDRAL
NSSVFER
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaattacgggttggggtgatctttggcggtaaatcggctgagcatgaggtgtct
ctgcagtcggcaaaaaacattgtggacgctatcgacaaagagaagtttgacgtcacgctg
ctggggatcgacaagcaggggcaatggcacattaacgatgcttccaattacctgctgaat
gcggaaaacccggcgctgatcgcgctgaaccgctcaaataaaaatgtggcgctgatcccc
ggtcaggaaaaacagcaactgattgaggcgagcagtgccggcgcactgggccagctcgac
gtggtattcccgatcgtgcatggcacgctgggcgaggacggttcactgcaggggctgttg
cggatggccaatatgccgttcgtcggtgccggcgtgttgggttcggcggtcagcatggac
aaagacgtcaccaaacgcctgctgcgcgatgccgggctggcggttgccccctttgtcacc
ctgacgcgcaccaaccgcagcaaatacgatttcgatcagcttagcgaacgtttgggcctg
ccgttgtttatcaaaccggctaaccagggctcttcggtgggggtcagcaaggtgcaggat
cgggccggctttgacgccgctctggcgctggcgttcagcttcgatcacaaagtgctggtg
gagtcggcgattgtcggccgcgaaattgagtgcgcggtgttgggcaatgacgaaccgcag
gccagcctgtgtggtgaaatcgtgctgagcgacgctttctattcctacgacaccaaatac
atcaacgagcagggcgcgcaggtagtggtgccggcagagatcgcaccggaagtcagcgac
aaaattcgcgacgtggcgctaaaagcgttccgggcactggaatgcttcggcctggcgcgc
gttgacgtgttcctgacgccggacaacaacgtggtgattaacgagatcaacacgctgccg
ggcttcaccaatatcagcatgtatcccaaactgtgggcagccagcggcgtcagctacagc
aagctgattacccggttgatcgagctggcgcttgaacgccatcagcaagatcgcgcgctg
aacagctcggtgttcgagcggtaa

DBGET integrated database retrieval system