KEGG   Serratia plymuthica PRI-2C: Q5A_008285Help
Entry
Q5A_008285        CDS       T04576                                 

Gene name
ltaE
Definition
(GenBank) Low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sply  Serratia plymuthica PRI-2C
Pathway
sply00260  Glycine, serine and threonine metabolism
sply01100  Metabolic pathways
sply01110  Biosynthesis of secondary metabolites
sply01120  Microbial metabolism in diverse environments
sply01130  Biosynthesis of antibiotics
sply01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sply00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q5A_008285 (ltaE)
Enzymes [BR:sply01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Q5A_008285 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ANS42126
UniProt: A0A1B1KNX2
Position
complement(1750273..1751289)
Genome map
AA seq 338 aa AA seqDB search
MLIDLRSDTVTRPCTAMRQAMAQAEVGDDVYGDDPTVNALEAEAVRLSGKEAALFLPSGT
QANLVALLSHCQRGDEYIVGQQAHNYKYEAGGAAVLGSIQPQPIEANPDGTLPLDKVAAA
IKPDDIHFARTRLLSLENTISGRVLPQEYLQQAWRFTREHQLALHIDGARIFNAAVALNL
PLKDIVQYCDTFTICLSKGLGAPIGSLLCGSEAFIQRAVRWRKMTGGGLRQAGILAAAGL
YALEHNVERLRDDHDNAKWLEQQLQGMGVEIAEPGAQTNVLYLRQSPELAAKLGPWMRER
GVLISSGPLTRILTHLDVSRQDLQQVVDLWREFLRQHA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcttattgatctacgcagtgataccgtgacccgcccctgtaccgccatgcgccaagcc
atggcgcaggccgaagtgggcgatgacgtctatggcgatgatcccacggtaaacgcgctg
gaggccgaagcggttcgtctgtccggcaaggaagcggcgctgtttctgccgagcggcacc
caggccaacctggtggcgctgttgagtcactgtcagcgcggcgacgaatatattgtcggc
cagcaggctcataactataaatacgaggccggcggcgcggcggtgctcggcagtatccag
ccacagccgattgaggcgaacccggacggcaccctgccgctggacaaggtagcggcggca
atcaaacccgatgacattcacttcgccagaacccgtctgctgagtctggaaaacaccatc
agcggccgcgtgctgccgcaggagtacctgcaacaggcctggcggttcacccgcgagcat
cagttggcgctgcacatcgacggcgcgcgcatcttcaatgccgccgtcgcgcttaatctg
ccgctgaaagacattgtgcagtattgcgacaccttcaccatctgcctgtcgaaagggctg
ggcgcgccgataggttcgctgctgtgcggcagtgaagcctttattcagcgcgccgtgcgc
tggcgcaaaatgaccggcggcggcctgcgccaggccggtattctggcggcggcaggtttg
tatgcgcttgaacataacgtcgaacggctgcgcgatgatcacgacaacgccaaatggctg
gagcagcaattgcagggaatgggcgtggagattgccgaaccgggcgcgcaaaccaacgtc
ctgtacctgcgccaatcgccagaattggcggctaaactggggccgtggatgcgagagcgt
ggcgtgctgatcagcagcgggccactgacgcgcattctgacccatctcgacgtcagccgt
caggatctgcagcaagtcgtcgatttatggcgggagttcctccggcagcatgcctga

DBGET integrated database retrieval system