KEGG   Serratia plymuthica PRI-2C: Q5A_014195Help
Entry
Q5A_014195        CDS       T04576                                 

Gene name
selD
Definition
(GenBank) Selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
sply  Serratia plymuthica PRI-2C
Pathway
sply00450  Selenocompound metabolism
sply01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sply00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Q5A_014195 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sply03016]
    Q5A_014195 (selD)
Enzymes [BR:sply01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     Q5A_014195 (selD)
Transfer RNA biogenesis [BR:sply03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Q5A_014195 (selD)
 Prokaryotic Type
    Q5A_014195 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ANS43290
UniProt: A0A1B1KS77
Position
complement(3005707..3006750)
Genome map
AA seq 347 aa AA seqDB search
MTSPTIRLTQYSHGAGCGCKISPKVLETILHSEREKFVDPRLLVGNETRDDAAVYDIGNG
VGIISTTDFFMPIVDNPFDFGRIAATNAISDVYAMGGKPIMAIAILGWPIATLSPEVAQQ
VIDGGRYACQQAGIALAGGHSIDAPEPIFGLAVTGIVNTERVKKNSAAQAGTQLFLTKPL
GIGVLTTAEKKSKLRPEHEGLATEVMCQLNKPGADFAEVAGVTAMTDVTGFGLLGHLSEV
CQGSGLQATLWFDRVPKLPDVERYIAEGCVPGGTGRNFDSYGHLIGEMTDLQRQLLCDPQ
TSGGLLLAVLPEAEQQVLAIAERHGIQLTAIGELHTATPGKPLIEVV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgccaacgatccgtttgacccagtacagccatggtgccggctgtggttgcaaa
atctcgccgaaagttctcgaaaccattctgcatagcgaacgtgaaaagtttgtcgatccg
cgcttgctggtgggtaatgaaacccgcgacgatgcggcggtgtatgacatcggcaatggc
gttggtatcatcagtaccaccgacttttttatgccgatcgtcgacaatccgttcgatttc
ggccgtattgccgccaccaacgccatcagtgacgtttacgccatgggcggcaaaccgatc
atggcgatagccattctcggctggccaatcgccacactgtcgccggaagtggcacagcag
gtcattgacggtgggcgttacgcctgccaacaggcggggatcgcgctggccggcggccac
tcgattgatgcgcctgaacctatttttggcctggcggtaaccggtatcgttaataccgag
cgggtcaagaaaaacagtgccgcgcaagccggcacccaattattcctcaccaagccgctg
ggtattggcgtactgaccaccgccgagaagaaaagcaaactgcgccctgaacatgaaggc
ctggcgactgaggtgatgtgccaactgaacaaaccgggagcggactttgccgaggtcgcc
ggcgtgacggcgatgactgacgtcaccggctttgggctgctgggtcacctgagcgaggtt
tgtcagggttccggtctgcaggcgacgctgtggtttgaccgggtaccgaaactgccggat
gtcgaacgttatatcgccgaaggctgcgtgccgggcggtaccggacgtaattttgacagc
tatggccacctgattggcgaaatgaccgatctgcagcgccaattgctgtgcgatccgcag
acgtccggtggcctgctgctggcggtgcttcccgaagcggaacagcaggtgctggcgatt
gccgaacgccacggcattcagctcaccgccatcggtgaactgcatacggcaacgccgggc
aagccactgattgaggttgtgtag

DBGET integrated database retrieval system