KEGG   Serratia plymuthica PRI-2C: Q5A_021615Help
Entry
Q5A_021615        CDS       T04576                                 

Gene name
phbA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sply  Serratia plymuthica PRI-2C
Pathway
sply00071  Fatty acid degradation
sply00280  Valine, leucine and isoleucine degradation
sply00310  Lysine degradation
sply00362  Benzoate degradation
sply00380  Tryptophan metabolism
sply00620  Pyruvate metabolism
sply00630  Glyoxylate and dicarboxylate metabolism
sply00640  Propanoate metabolism
sply00650  Butanoate metabolism
sply00900  Terpenoid backbone biosynthesis
sply01100  Metabolic pathways
sply01110  Biosynthesis of secondary metabolites
sply01120  Microbial metabolism in diverse environments
sply01130  Biosynthesis of antibiotics
sply01200  Carbon metabolism
sply01212  Fatty acid metabolism
sply02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sply00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Q5A_021615 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    Q5A_021615 (phbA)
   00640 Propanoate metabolism
    Q5A_021615 (phbA)
   00650 Butanoate metabolism
    Q5A_021615 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Q5A_021615 (phbA)
   00072 Synthesis and degradation of ketone bodies
    Q5A_021615 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Q5A_021615 (phbA)
   00310 Lysine degradation
    Q5A_021615 (phbA)
   00380 Tryptophan metabolism
    Q5A_021615 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Q5A_021615 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Q5A_021615 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Q5A_021615 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sply04147]
    Q5A_021615 (phbA)
Enzymes [BR:sply01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Q5A_021615 (phbA)
Exosome [BR:sply04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q5A_021615 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ANS44744
UniProt: A0A1B1KWC1
Position
complement(4602344..4603534)
Genome map
AA seq 396 aa AA seqDB search
MKEVVVVAAKRTATGSFHGALASQPATTLGAAVIRALLQQSQVPAEEIDQVIIGQVLTAG
CGQNPARQSALLAGLPVTTNALTINKVCGSGIKAVHLAMQAIQCGDAEMVIAGGQENMSL
APHIFASSRTGQRLGHGQLKDTLIHDGLWDAHCDIHMGVTAENVARKFNLSRAQQDEYAL
LSHQRALTAQRNGYFNDEIVAVECQRRGKESVFFSQDEGPRDTSFEKLSGLKPVFEQNGT
VTAGNSSSLNDGAAAVLLCSREKAEQLKLPVLASLGCFSNTGITPDVMGAAPIEAIRQCL
DKQHWQASEVDALESNEAFAAQALAVLHSSGVPGERVNPCGGAIALGHAIGASGCRILVT
LIHHMQRNQLQKGIAALCIGGGEGVALAVKRPAQCA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtggtagtggtcgcagcaaaaagaacggcaacggggagttttcatggcgcg
ctggccagccaacctgcgacgacattgggtgcggcagtgatccgggcgttgctgcaacag
agtcaggttccggcagaagagattgatcaggtgattattggccaggtactcaccgcaggc
tgcggacagaatccagcccgccagtcggcattgctcgctggattaccggtgaccacgaat
gcgctgactatcaataaagtgtgcggttccggtattaaggctgtgcacttggcgatgcag
gctattcaatgcggtgatgcagaaatggttatcgccggtggtcaagagaatatgtcactg
gcaccccatatttttgcctcttcacgtaccggccagcggctgggccatggtcagctaaaa
gataccttgattcatgatggtttatgggacgcccattgcgatattcatatgggcgttact
gccgaaaacgtcgcgcgcaagttcaacttgtcacgtgctcaacaagatgagtacgcgctg
ctgtcacatcagcgtgcattaacggcacagcgtaacggctatttcaacgacgagatcgtg
gcagtggagtgtcagcgtcgcggcaaagagagcgtgtttttttcccaggacgaagggccg
cgtgacaccagttttgagaaattatccgggctgaagccggtttttgagcagaacggtact
gtcaccgccggcaactcctcatctctgaatgatggtgccgccgctgtattgctctgtagc
cgggaaaaagcggagcagcttaagttgccggtactggccagcctgggctgtttcagcaac
acaggtattacgccggatgtgatgggagcagcaccgattgaagctattcgtcaatgcctt
gataaacagcattggcaagccagcgaagtcgatgcgcttgaatccaatgaagcctttgct
gcccaggctctagcggtactgcactcatcaggtgtgccaggagagcgggtgaatccttgt
ggcggcgctatcgccctggggcacgccataggggcatcaggctgccgtattttagttacg
cttatccaccatatgcagcgcaaccagctacaaaaaggcattgccgcactctgtataggc
ggaggggaaggagtggcgctggcggtaaaacgccctgctcagtgcgcctaa

DBGET integrated database retrieval system