KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_1270
Entry
spyM18_1270       CDS       T00079                                 
Name
(GenBank) putative antirepressor
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
SSDB
Motif
Pfam: ANT Bro-N Rootletin
Other DBs
NCBI-ProteinID: AAL97876
Position
complement(1063461..1064204)
AA seq 247 aa
MELQVFTNEQFGEVRTADINGESFFNLKDCCKILEIKNSKDVVKRLNPKGVVTTDLLTNG
GTQQANFINESNFYKLVFQSRKPEAEKFADWVTSEVLPSIRKHGAYMTEQTLEQALTSPD
FLIRLANELKEEKERSRQLEAEKSILSVENMVMKPKADYFDDLVDRNLLTSFRETAKQLK
VKERRFIQFLLDKKYVYRDKKGKLMPFADKNSGLFEVKESVNEKTNWAGTQTLITPKGRE
TFRLLFI
NT seq 744 nt   +upstreamnt  +downstreamnt
atggaattacaagtatttactaatgaacagtttggagaagtgcgtacagcagatattaac
ggagaatcgtttttcaatttgaaagactgctgtaaaattttagaaatcaaaaatagcaaa
gatgttgttaaacgacttaacccaaagggggtcgttactaccgacctccttacgaatggc
ggaactcaacaagctaacttcatcaacgaaagcaatttctacaagttagtcttccaatct
cgcaagccagaagctgaaaagtttgcagactgggtcacatcggaagtcctaccatcaatc
cgcaaacacggcgcttatatgactgaacaaaccttggaacaggcacttaccagcccagac
ttcctcatacggcttgccaatgagttaaaagaggaaaaggagcgcagtcgtcagttagag
gctgagaagtcaattttgagcgttgagaacatggttatgaagccaaaggctgattatttt
gatgatttggttgaccgcaatttattgactagtttccgtgaaactgctaaacaattaaaa
gttaaggaacgacgattcattcaatttctacttgataagaaatacgtttacagagacaag
aaaggtaagcttatgccgtttgcagataaaaatagcgggttatttgaagtcaaggaaagt
gttaacgaaaagaccaactgggcaggaactcaaaccttaataactccaaaaggtcgtgaa
acttttagactgttatttatttaa

DBGET integrated database retrieval system