KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_0045Help
Entry
spyM18_0045       CDS       T00079                                 

Gene name
adhP
Definition
(GenBank) putative alcohol dehydrogenase I
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
spm00010  Glycolysis / Gluconeogenesis
spm00071  Fatty acid degradation
spm00350  Tyrosine metabolism
spm00625  Chloroalkane and chloroalkene degradation
spm00626  Naphthalene degradation
spm01100  Metabolic pathways
spm01110  Biosynthesis of secondary metabolites
spm01120  Microbial metabolism in diverse environments
spm01130  Biosynthesis of antibiotics
spm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    spyM18_0045 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    spyM18_0045 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    spyM18_0045 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    spyM18_0045 (adhP)
   00626 Naphthalene degradation
    spyM18_0045 (adhP)
Enzymes [BR:spm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     spyM18_0045 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N Methyltransf_25 Sacchrp_dh_NADP Methyltransf_31 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AAL96873
Position
61469..62485
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQASTGVEVVEHDLPNVGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEEIGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGVAPGQWIVIFGAGGLGNLAVQ
YAKKVFNAHVVAVDINNDKLELAKEVGADILVNGKEIEDVPGYIQEKIGGAHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGA
EGLVAPVVEKVPVDTAPEVFDEMERGLIQGRKVLDFIS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtagttgttaatcaagctagtacaggtgtcgaagttgttgagcatgatctt
ccaaatgttggtcatggtgaagcgcttgttaaagtagaatactgtggcgtttgtcatact
gatttacacgttgcacatggcgattttggtcaggtaccaggacgtattttggggcacgaa
ggtattggtatagtagaagaaattggagaaggcgtaacatccttaaaggttggtgatcgt
gtctctattgcatggttctttgaaggatgtggtcattgcgaatactgtactacagggcgt
gagacactttgtcgtagtgttaaaaatgctggatacagtgttgatggaggaatgagtgaa
tatgcagtagtaacagctgattatgcagttaaagttccagaaggtttagacccggctcaa
gcttcttccattacttgtgctggtgtaacaacttataaagctattaaagaggcaggtgtt
gctccaggccaatggattgttatctttggggcaggtggccttggaaatctggctgttcaa
tacgctaaaaaagtctttaatgcacatgttgtcgcagtggacattaataatgataaactt
gagttagctaaagaagttggcgcagatattttagttaacggcaaagaaattgaagatgtt
ccaggctatattcaagaaaaaatcggtggagcacatggtgttgtggtaacggctgtttct
aaagttgcttttaaccaagcaattgatagtgtccgtgccggtggaacagttgtagccgta
ggtcttccatcagaatacatggaactgtctatcgtaaaaactgttttagatggtatcaaa
gtggtcggatcacttgtagggacacgtaaagacttggaagaagcctttgcctttggtgca
gaaggtctggttgctccggttgtcgaaaaagttccagttgacactgctccagaagtcttt
gatgaaatggaacgtggtttaatccaagggcgcaaggtcttagatttcatcagctaa

DBGET integrated database retrieval system