KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_1645Help
Entry
spyM18_1645       CDS       T00079                                 

Gene name
atoB
Definition
(GenBank) putative acetyl-CoA:acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
spm00071  Fatty acid degradation
spm00072  Synthesis and degradation of ketone bodies
spm00280  Valine, leucine and isoleucine degradation
spm00310  Lysine degradation
spm00362  Benzoate degradation
spm00380  Tryptophan metabolism
spm00620  Pyruvate metabolism
spm00630  Glyoxylate and dicarboxylate metabolism
spm00640  Propanoate metabolism
spm00650  Butanoate metabolism
spm00900  Terpenoid backbone biosynthesis
spm01100  Metabolic pathways
spm01110  Biosynthesis of secondary metabolites
spm01120  Microbial metabolism in diverse environments
spm01130  Biosynthesis of antibiotics
spm01200  Carbon metabolism
spm01212  Fatty acid metabolism
spm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    spyM18_1645 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    spyM18_1645 (atoB)
   00640 Propanoate metabolism
    spyM18_1645 (atoB)
   00650 Butanoate metabolism
    spyM18_1645 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    spyM18_1645 (atoB)
   00072 Synthesis and degradation of ketone bodies
    spyM18_1645 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    spyM18_1645 (atoB)
   00310 Lysine degradation
    spyM18_1645 (atoB)
   00380 Tryptophan metabolism
    spyM18_1645 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    spyM18_1645 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    spyM18_1645 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    spyM18_1645 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spm04147]
    spyM18_1645 (atoB)
Enzymes [BR:spm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     spyM18_1645 (atoB)
Exosome [BR:spm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   spyM18_1645 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAL98194
Position
1370077..1371264
Genome map
AA seq 395 aa AA seqDB search
MKNIVIVEALRTPIGAFGGSFKSVSAVELGTTVLKKILDKTQVKPEMVDEVILGNVLHAG
LGQNVARQIAIHSGIPSDKTAFTLDMVCGSGLKAIQLATQSIMLGDADIVIAGGVENMSQ
AAYVSTQHRFGQRLGNSQLIDTLVHDGLTDAFNNYHMGITAENVAQKYGISREEQDQFAL
ESQEKAAKALENHRFADEIVPVSVPQRRKDPLIVTTDEYPKVDTSLEKLQQLRPAFLPKE
GTVTAGNASGINDGAALLMLMTEEKALELGLTPLVTIESYASAGVAPELMGAGPIPATQK
VLKKAGLTTSDLDLVESNEAFAAQSLAVLKDLKLNPEIVNVNGGAIALGHPIGASGARIL
VTLIHEMKKRQVTRGLATLCIGGGQGTAVIVKNNT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatagttatcgttgaagctttacgaactcctatcggagcttttggaggctcc
tttaaaagtgtctctgctgttgaacttggaacaactgtactgaaaaaaatccttgataaa
acgcaagtaaagcctgaaatggttgatgaagtcatcctaggaaacgtccttcatgcagga
ttagggcaaaacgttgccagacagattgctattcactctggcatccctagtgataaaaca
gccttcacgcttgatatggtctgtggttcaggacttaaagcaatccaattagctacgcaa
agcatcatgcttggtgacgctgatatcgttattgctggtggtgtcgaaaacatgtcacag
gcagcctatgtgtcaactcagcaccgttttggacagcgacttggtaatagtcaattgatt
gatactcttgttcatgatggattgacagatgctttcaacaattatcatatgggtatcact
gctgaaaacgttgctcagaaatatggcatctcaagagaagagcaagatcaatttgcttta
gaaagccaagaaaaagctgctaaggcattagaaaatcatcgttttgctgacgaaattgtc
cctgtctctgtgcctcaacgacgcaaagaccctttaattgttacaacagatgaataccca
aaagttgacacaagccttgaaaaattacagcaattacgtcctgccttcctccctaaagaa
ggaaccgttactgctgggaatgcctcaggaataaacgatggtgcagccttattgatgtta
atgactgaagaaaaagctcttgaattagggttaacacctttagtcactattgaaagctat
gctagtgcaggtgttgcacctgaactgatgggagctggaccaattcctgccactcaaaaa
gtccttaagaaagctggattaacaacttctgatttggacttagtggagtccaatgaagca
tttgcagcacagtccttggcggttttaaaagatttaaagttaaacccagaaattgtgaat
gttaatggaggagccatcgctttaggtcatcctattggtgccagtggcgctcgcattcta
gtcacattaatccacgaaatgaaaaaacgccaagtaaccagaggactagcaacactttgc
attggtggaggacaaggaactgctgttatcgtgaaaaacaatacttag

DBGET integrated database retrieval system