KEGG   Sphingobium sp. MI1205: K663_07575Help
Entry
K663_07575        CDS       T04383                                 

Definition
(GenBank) methionyl-tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
spmi  Sphingobium sp. MI1205
Pathway
spmi00450  Selenocompound metabolism
spmi00970  Aminoacyl-tRNA biosynthesis
spmi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spmi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    K663_07575
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    K663_07575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spmi01007]
    K663_07575
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spmi03016]
    K663_07575
Enzymes [BR:spmi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     K663_07575
Amino acid related enzymes [BR:spmi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   K663_07575
Transfer RNA biogenesis [BR:spmi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    K663_07575
 Prokaryotic type
   Other AARSs
    K663_07575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AMK17896
UniProt: A0A126R7A7
Position
1:complement(1583466..1585028)
Genome map
AA seq 520 aa AA seqDB search
MSQPFTITTAISYPNGRPHIGHAYEVIATDAIARFQRMTGRDVFFQTGTDEHGLKMAQAA
RNRGIEPHALADEMSGYFKDMNDRLNISYDRFIRTSEPDHHRASQAIWQAMEANGDLYLG
RYEGWYSIRDEAFYDEKELVDGDGGEKLSPQGTPVEWTVEESWFFRLSAYQQRLLDLYNS
QPDFIQPDSRRNEIMRFVEGGLSDLSVSRTSFDWGVKVPGNDGHVMYVWVDALTNYLTGC
GYPDDANRMARYWSEGGDITHIIGKDIVRFHAVYWPAFLMSAKLPLPKQVFGHGFLLNRG
EKMSKSVGNVADPMELADRFGVDQLRYFLLSEVTFGNDGSYSAEAIVARSNSDLANSFGN
LAQRTLSFIAKNLEGRLPQPALQDVDSDLLTTIAGAAKSFQAAMSDLAPSVAIEAWMRAV
FACNAYIDVQAPWALRKTDPARMEAVLATLYEAIAGLAIIIQPVIPASAKALLDQMGIGG
EGRTYGAIGSDFYAQLCATGFILTPPKPLFPRLELNEADA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcctttcacgatcaccaccgccatcagctatcccaacggccgcccgcatatc
ggccatgcctatgaggtaatcgccactgatgcgatcgcgcggttccagcggatgacgggt
cgtgatgtattcttccagaccggcacggatgagcatggcctgaaaatggcccaggccgcc
cgcaaccgaggcatcgaaccgcatgcgctagccgatgaaatgtccgggtatttcaaggat
atgaacgacaggctgaatatcagctatgatcggtttatccgcaccagcgagcctgatcac
catcgcgcgtctcaggccatatggcaggcgatggaggcgaatggcgacctttatctgggg
cgctatgagggctggtactcgatccgcgacgaagccttctacgacgaaaaggaactggtt
gacggggacggcggcgaaaagctgtcgccacagggcaccccggtcgaatggaccgtcgag
gaaagctggtttttccgcctgtccgcttatcagcaaaggctgctcgacctttacaacagc
caacccgatttcatccagcccgacagccgccgcaatgaaatcatgcgctttgtggaaggt
ggcctctcggatctcagcgtttcgcgcaccagcttcgactggggcgttaaggtgccgggc
aatgacggtcatgtcatgtatgtatgggtcgatgcgctcacaaattacctgaccggctgc
ggatatcccgacgatgctaatcgcatggcgcgctactggtcggaaggcggcgatatcacg
catattatcggcaaggatattgtgcgttttcatgccgtttactggccagcgttcctgatg
agtgcaaagctaccgctgcccaagcaggtctttggccacggcttcctgctcaatcggggc
gagaagatgtcgaaatcggtcggcaatgtcgctgacccgatggaactggccgatcgtttc
ggcgtcgatcagctgcgttatttcctgctgtccgaagtcacgttcggcaatgacggcagc
tatagcgccgaagccattgtggcgcgctccaacagcgatctggcgaacagcttcggcaac
ctcgcgcaacggaccttgagcttcatcgcaaagaatctcgaaggtcgcctgccgcagcct
gcgcttcaggatgtcgatagcgacctgctcacaaccatcgcgggcgcggctaagagcttt
caggcagcaatgtccgatctggcgccatcggtagcgatagaggcatggatgcgggctgtc
ttcgcctgcaacgcctacatcgatgtccaggcgccctgggcgctccgcaagaccgacccc
gcccgtatggaagccgtgctggcgacgctgtacgaagccattgccggacttgccatcatc
atccagcctgtcatcccggccagcgcgaaggcgctgctggaccagatggggataggcggg
gaagggcggacttacggcgcgatcggttccgatttctatgcccaactgtgtgccaccggc
tttatcctcactccgcccaagcctctttttccccgccttgaattgaatgaagcggacgcc
tga

DBGET integrated database retrieval system