KEGG   Sphingobium sp. MI1205: K663_20508Help
Entry
K663_20508        CDS       T04383                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spmi  Sphingobium sp. MI1205
Pathway
spmi00071  Fatty acid degradation
spmi00072  Synthesis and degradation of ketone bodies
spmi00280  Valine, leucine and isoleucine degradation
spmi00310  Lysine degradation
spmi00362  Benzoate degradation
spmi00380  Tryptophan metabolism
spmi00620  Pyruvate metabolism
spmi00630  Glyoxylate and dicarboxylate metabolism
spmi00640  Propanoate metabolism
spmi00650  Butanoate metabolism
spmi00900  Terpenoid backbone biosynthesis
spmi01100  Metabolic pathways
spmi01110  Biosynthesis of secondary metabolites
spmi01120  Microbial metabolism in diverse environments
spmi01130  Biosynthesis of antibiotics
spmi01200  Carbon metabolism
spmi01212  Fatty acid metabolism
spmi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    K663_20508
   00630 Glyoxylate and dicarboxylate metabolism
    K663_20508
   00640 Propanoate metabolism
    K663_20508
   00650 Butanoate metabolism
    K663_20508
  09103 Lipid metabolism
   00071 Fatty acid degradation
    K663_20508
   00072 Synthesis and degradation of ketone bodies
    K663_20508
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    K663_20508
   00310 Lysine degradation
    K663_20508
   00380 Tryptophan metabolism
    K663_20508
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    K663_20508
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    K663_20508
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    K663_20508
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spmi04147]
    K663_20508
Enzymes [BR:spmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     K663_20508
Exosome [BR:spmi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   K663_20508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DAO_C Porin_3
Motif
Other DBs
NCBI-ProteinID: AMK20458
UniProt: A0A126RE55
Position
pMI1:complement(254581..255750)
Genome map
AA seq 389 aa AA seqDB search
MTASIIGWGHTPFGKQPEETVETLVVAAANEALAHAGVSAEDVDSIVLGHFNAGFSKQNL
TSALVLQANPQLRFKPAVRTENACASGSAAVFQGVNAIEARRASIVLVVGVEKMTDSSSP
QIAENLLRASYLAEEGDTEGGFAGIFGKIAQSYFQKYGDQSDALARIAAKNHRNGVSNPW
AQMRKDLGYEFCRTESERNPFVAGPLKRTDCSLVSDGAAAIVLAAPDIAAEAQRAVRFRG
RGHVQDFLPMSRRDITRFEGCTQAWQRAFAEANIALDDLSLVETHDCFTIAELIEYEAMG
LVPSGQGARAALEGWTEIGGRLPVNASGGLKAKGHPIGATGVSMHALCAMQLCGEAPGDM
QVPGAELAGVFNMGGAAVANYASVLERVR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcctcgatcataggctggggccataccccgttcgggaagcaacctgaagaaacc
gtcgaaacgttggtcgttgcggcggcaaacgaagcgttggcccatgccggcgtcagcgcc
gaagacgtggattcaatcgttcttggccatttcaacgccggattctcaaagcaaaatcta
acttccgcgctggtgctccaggccaatccgcagctacgattcaagccggccgtgcgaacg
gagaatgcgtgtgcctccgggtcggccgcagttttccaaggcgtcaatgccatcgaagcc
cgacgtgccagcatagtcctcgtggttggcgtcgaaaaaatgaccgactcttcatctccc
cagatcgccgaaaatctgcttcgcgcatcctatcttgcagaagagggcgacacagagggt
ggattcgccggtatcttcggcaagatcgcgcaatcctattttcagaaatatggcgaccag
agcgacgctttggcgaggatcgccgccaagaatcacagaaatggcgtcagtaatccttgg
gcgcagatgcgcaaagatcttggctatgaattctgtcgcaccgagagcgaacgcaatccc
tttgtggcaggaccgcttaagcgaactgactgttccctcgtctcagatggtgctgccgcc
atcgttttggccgcaccggatatcgctgccgaggcgcagagggcggtgcgctttcgcggc
cgaggacatgtgcaggatttcctgcctatgtcgcgccgcgacatcacccggttcgagggt
tgcacgcaagcctggcaacgggcctttgccgaggcgaatatcgcgctcgatgatctttcg
cttgtcgagacccatgattgcttcaccatcgccgaactgatcgaatatgaggcgatgggc
ctcgttcccagcggtcaaggcgcgcgggctgccctggaaggctggacggagatcggcgga
cgcctcccggtgaacgcctcggggggccttaaggccaaagggcacccgattggggccacc
ggcgtgtcgatgcatgccctttgcgcgatgcaactatgcggcgaagcacccggagatatg
caggttcctggcgccgaactcgctggagtcttcaacatgggtggcgcggcagtcgccaat
tacgccagcgtgctcgagcgcgtgcgctga

DBGET integrated database retrieval system