KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0251
Entry
SP_0251           CDS       T00057                                 

Name
(GenBank) putative formate acetyltransferase
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: AAK74430
UniProt: A0A0H2UN81
Position
220066..222504
AA seq 812 aa
MVNTEVARTTIKTEYFGSLTERMNKYREDVLNKKPYIDAERAVLATRAYERYKEQPNVLK
RAYMLKEILENMTIYIEEESMIAGNQASSNKDAPIFPEYTLEFVLNELDLFEKRDGDVFY
ITEETKEQLRSIAPFWENNNLRARAGALLPEEVSVYMETGFFGMEGKMNSGDAHLAVNYQ
KLLQFGLRGFEERARKAKVALDLTDPASIDKYHFYDSIFIVIDAIKVYAKRFVALAKSLA
ENANPKRKKELLEIADICSRVPYEPATTFAEAIQSVWFIQCILQIESNGHSLSYGRFDQY
MYPYMKADLESGKETEDSIVERLTNLWIKTITINKVRSQSHTFSSAGSPLYQNVTIGGQT
RDKKDAVNPLSYLVLKSVAQTHLPQPNLTVRYHAGLDARFMNECIEVMKLGFGMPAFNND
EIIIPSFIAKGVLEDDAYDYSAIGCVETAVPGKWGYRCTGMSYMNFPKVLLITMNDGIDP
ASGKRFAPSFGRFKDMKNFSELENAWDKTLRYLTRMSVIVENSIDLSLEREVPDILCSAL
TDDCIGRGKHLKEGGAVYDYISGLQVGIANLSDSLAAIKKLVFEEERISPSQLWHALETD
YAGEEGKVIQEMLIHDAPKYGNDDDYADKLVTAAYDIYVDEIAKYPNTRYGRGPIGGIRY
SGTSSISANVGQGRGTLATPDGRNAGTPLAEGCSPSHNMDQHGPTSVLKSVSKLPTDEIV
GGVLLNQKVNPQTLAKEEDKLKLIALLRTFFNRLHGYHIQYNVVSRETLIDAQKHPEKHR
DLIVRVAGYSAFFNVLSKATQDDIIGRTEHTL
NT seq 2439 nt   +upstreamnt  +downstreamnt
atggtaaatacagaagtagcaagaacaacaatcaagacagaatattttggcagccttact
gaaaggatgaacaaatatcgagaagatgttttaaataaaaaaccttatattgatgctgag
agagcagttctagcaacacgcgcctatgaacgatacaaggaacaacctaatgtcctaaaa
cgtgcatatatgctgaaagaaattttggaaaatatgactatctatattgaagaagaatct
atgattgcgggaaatcaagcttcttccaataaagatgctcctatttttccggaatatacg
ctagaatttgttctcaatgagttggatctttttgaaaagcgtgatggagatgttttctat
attacagaagaaacaaaagaacaacttagaagtattgctccgttttgggaaaataataat
ttacgtgctagagctggtgccttattacctgaagaagtgtctgtttatatggaaacagga
ttcttcggtatggaaggtaagatgaattctggagatgctcacttagcagttaactatcag
aaacttttgcaatttggtttaagaggttttgaagagcgggctcgtaaagcaaaagtagct
ctagatttaacagatccagcaagtattgataaatatcatttttacgactctatatttatc
gtaatcgatgctattaaagtatatgcaaagcgctttgttgctcttgctaaaagtttagcc
gaaaatgcaaatcctaaacgtaagaaagaattacttgagattgcagatatttgctctaga
gtcccatatgaaccggcaactacttttgcagaagctattcaatcagtttggtttattcaa
tgtattttacaaattgaatctaatggccactctctttcatatggccgttttgatcaatat
atgtatccatatatgaaggctgatttagaaagtggtaaagaaacagaagatagcattgtt
gaacgtctgacaaatctttggattaagacaattacaattaataaggttcgcagtcaatca
catacattttcttcagcaggaagtcctttatatcaaaatgttacaattggtggacagact
cgagataagaaggatgctgttaacccattatcttatttggtattaaaatcagttgcacaa
acccatctaccgcaacctaatctaactgtacgttaccatgcaggtttagatgctcgtttc
atgaatgagtgtattgaagtgatgaaacttggttttggtatgcctgcatttaataatgat
gagattattattccttcttttattgcaaaaggagtattggaagatgatgcttatgattac
agtgccattggatgtgttgaaacggcagttccagggaaatggggctatcgttgcacaggt
atgagttatatgaacttccctaaggttctacttatcacgatgaatgatggaattgatccg
gcttcgggtaaacggtttgcaccaagctttggtcgttttaaggatatgaagaacttttct
gaattagaaaatgcttgggataaaacactaagatatttgacacgaatgagtgttattgtt
gaaaattctattgatttatcattggaacgagaagttcctgatattctatgttcagcattg
actgatgattgtattggtcgtggaaaacaccttaaagaaggtggagcagtatatgattat
atatcaggattgcaagttggaattgcaaatttgtcggattcattagctgcaattaaaaaa
ttggtgtttgaggaagaacgtataagcccaagtcagctttggcatgcactggaaacagat
tatgccggagaagaaggtaaggtcattcaagaaatgttgattcatgatgcacctaagtat
ggtaatgatgatgattatgctgacaaattggttactgctgcttatgacatttatgttgat
gaaattgctaaatatcctaatacacgttatggaagagggcctattggaggaattcgttat
tcaggaacatcttctatctcagccaacgtagggcagggacgtggaacattagcaactcca
gatggacgcaacgcgggtacaccgttagcagagggttgttcaccatcacataatatggat
caacacggccctacatctgttttaaaatctgtttcaaaattaccaacagatgaaatcgta
ggtggggttctcttaaatcagaaagtaaatcctcaaacgttagccaaagaagaagataaa
ttaaaactaattgctttgttacgaacattctttaatcgtttacatgggtaccatattcaa
tacaatgttgtttccagagagacgctgattgacgctcagaaacatcctgaaaaacacaga
gacttaattgttcgtgttgcaggatactctgcattcttcaatgttctttctaaggcaacc
caagatgacattataggacgtactgagcatactttgtaa

DBGET integrated database retrieval system