KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0019Help
Entry
SP_0019           CDS       T00057                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
spn00230  Purine metabolism
spn00250  Alanine, aspartate and glutamate metabolism
spn01100  Metabolic pathways
Module
spn_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:spn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SP_0019 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SP_0019 (purA)
Enzymes [BR:spn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     SP_0019 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AAK74211
UniProt: P65887
Position
22832..24118
Genome map
AA seq 428 aa AA seqDB search
MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF
FPEKISVIGNGMVVNPKSLVKELSYLHEEGVTTDNLRISDRAHVILPYHIELDRLQEEAK
GDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERNLAEKNRLFEKLYDSKAI
VFDDIFEEYYEYGQQIKKYVIDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPFVTSS
NPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEYGTTT
GRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYYPASL
EQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPGREQT
NILESVWS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagttgttgttgtaggtacccaatggggtgatgaaggtaaagggaagattaca
gacttcctttcagcgaatgcagaagtgattgcacgttaccaaggtggtgataatgctggt
cacacgattgtgattgacggtaagaaatttaagttgcacttgattccatctgggattttc
ttccctgaaaaaatatctgtcattgggaatggtatggttgtaaatcctaaatctcttgta
aaagagttgagctatcttcatgaggaaggtgtaacaactgataacttgcgtatttctgat
cgtgcgcatgttattttgccttatcatatcgagttggatcgcttgcaagaagaagctaag
ggcgacaataagattggtacgacaattaagggaattggtccagcttatatggacaaggct
gctcgtgttggaattcgtattgcagatcttttagataaagatattttccgtgagcgttta
gaacgtaaccttgctgaaaagaatcgtctttttgaaaaattgtatgacagtaaagcgatt
gttttcgatgatatttttgaagaatattacgaatatggtcaacaaatcaagaaatacgtg
atagatacatctgttatcttgaatgatgcgcttgataatggcaaacgtgtgctttttgaa
ggtgcacaaggtgttatgctagatatcgaccaaggtacttatccatttgttacgtcatca
aaccctgtagctggtggtgtgacaattggttctggtgtcggtccaagcaagattgacaag
gttgtaggtgtatgtaaagcttatacgagtcgtgtaggagatggtcctttcccaactgag
ttgtttgatgaagtgggagaacgtatccgtgaagtgggtcatgaatatggtacaacaact
ggtcgtccacgtcgtgtaggttggtttgactcagttgtgatgcgtcatagccgtcgtgtt
tctggtattactaacctttctttgaactctattgatgttttgagcggtttggatactgtg
aaaatctgtgtggcctatgatcttgacggtcaacgtattgactactatccagctagtctt
gaacaattgaaacgttgcaagcctatctatgaagagttgccaggttggtcagaagatatt
accggagttcgcaatttggaagatcttcctgagaatgcgcgtaactatgttcgtcgtgtg
agtgaattggttggcgttcgtatttctactttctcagtaggtcctggtcgtgaacaaaca
aatattttagaaagtgtttggtcctaa

DBGET integrated database retrieval system