KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0042
Entry
SP_0042           CDS       T00057                                 

Gene name
comA
Definition
(GenBank) competence factor transporting ATP-binding/permease protein ComA
  KO
K12292  ATP-binding cassette, subfamily C, bacterial, competence factor transporting protein [EC:3.4.22.-]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
spn02010  ABC transporters
spn02020  Two-component system
spn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:spn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SP_0042 (comA)
  09132 Signal transduction
   02020 Two-component system
    SP_0042 (comA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SP_0042 (comA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spn02000]
    SP_0042 (comA)
Enzymes [BR:spn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     SP_0042 (comA)
Transporters [BR:spn02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    SP_0042 (comA)
SSDB
Motif
Pfam: ABC_membrane Peptidase_C39 ABC_tran Peptidase_C70 AAA_22 AAA_24 ABC_ATPase SMC_N AAA_33 AAA_16
Other DBs
NCBI-ProteinID: AAK74231
UniProt: Q03727
Position
40816..42969
AA seq 717 aa
MKFGKRHYRPQVDQMDCGVASLAMVFGYYGSYYFLAHLRELAKTTMDGTTALGLVKVAEE
IGFETRAIKADMTLFDLPDLTFPFVAHVLKEGKLLHYYVVTGQDKDSIHIADPDPGVKLT
KLPRERFEEEWTGVTLFMAPSPDYKPHKEQKNGLLSFIPILVKQRGLIANIVLATLLVTV
INIVGSYYLQSIIDTYVPDQMRSTLGIISIGLVIVYIFQQILSYAQEYLLLVLGQRLSID
VILSYIKHVFHLPMSFFATRRTGEIVSRFTDANSIIDALASTILSIFLDVSTVVIISLVL
FSQNTNLFFMTLLALPIYTVIIFAFMKPFEKMNRDTMEANAVLSSSIIEDINGIETIKSL
TSESQRYQKIDKEFVDYLKKSFTYSRAESQQKALKKVAHLLLNVGILWMGAVLVMDGKMS
LGQLITYNTLLVYFTNPLENIINLQTKLQTAQVANNRLNEVYLVASEFEEKKTVEDLSLM
KGDMTFKQVHYKYGYGRDVLSDINLTVPQGSKVAFVGISGSGKTTLAKMMVNFYDPSQGE
ISLGSVNLNQIDKKALRQYINYLSQQPYVFNGTILENLLLGAKEGTTQEDILRAVELAEI
REDIERMPLNYQTELTSDGAGISGGQRQRIALARALLTDAPVLILDEATSSLDILTEKRI
VDNLIALDKTLIFIAHRLTIAERTEKVVVLDQGKIVEEGKHADLLAQGGFYAHLVNS
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgaaatttgggaaacgtcattatcgtccgcaggtggatcagatggactgcggtgtagct
tcattagccatggtttttggctactatggtagttattattttttggctcacttgcgagaa
ttggctaagacgaccatggatgggacgacggctttgggcttggtcaaggtggcagaggag
attggttttgagacgcgagccattaaggcagatatgacgctttttgacttgccggattta
acttttccttttgttgcccatgtgcttaaggaagggaaattgctccactactatgtggtg
actgggcaggataaggatagcattcatattgccgatccagatcccggggtgaagttgact
aaactgccacgtgagcgttttgaggaagaatggacaggagtgactctttttatggcacct
agtccagactataagcctcataaggaacaaaaaaatggtctgctctcttttatccctata
ttagtgaagcagcgtggcttgattgccaatatcgttttggcaacactcttggtaaccgtg
attaacattgtgggttcttattatctgcagtctatcattgatacctatgtgccagatcag
atgcgttcgacactagggattatttctattgggctagtcatcgtctacatcttccagcaa
atcttgtcttacgctcaggagtatctcttgcttgttttggggcaacgcttgtcgattgac
gtgattttgtcctatatcaagcatgtttttcacctccctatgtccttctttgcgacacgc
aggacaggggagatcgtgtctcgttttacagatgctaacagtatcatcgatgcgctggct
tcgaccatcctttcgattttcctagatgtgtcaacggttgtcattatttcccttgttcta
ttttcacaaaataccaatctctttttcatgactttattggcgcttcctatctacacagtg
attatctttgcctttatgaagccgtttgaaaagatgaatcgggataccatggaagccaat
gcggttctgtcttcttctatcattgaggacatcaacggtattgagactatcaagtccttg
accagtgaaagtcagcgttaccaaaaaattgacaaggaatttgtggattatctgaagaaa
tcctttacctatagtcgagcagagagtcagcaaaaggctctgaaaaaggttgcccatctc
ttgcttaatgtcggcattctctggatgggggctgttctggtcatggatggcaagatgagt
ttggggcagttgattacctataataccttgctggtttactttactaatcctttggaaaat
atcatcaatctgcaaaccaagcttcagacagcgcaggttgccaataaccgtctaaatgaa
gtgtatctagtagcttctgagtttgaggagaagaaaacagttgaggatttgagcttgatg
aagggagatatgaccttcaagcaggttcattacaagtatggctatggtcgagatgtctta
tcggatatcaatttaaccgttccccaagggtctaaggtggcttttgtggggatttcaggg
tcaggtaagacgactttggccaagatgatggttaatttttacgacccaagtcaaggggag
attagtctgggtagtgtcaatctcaatcagattgataaaaaagccctgcgccagtacatc
aactatctgtctcaacagccctatgtctttaacggaacgattttggagaatcttcttttg
ggagccaaggaggggacgacacaggaagatatcttacgggcggtcgaattggcagagatt
cgagaggatatcgagcgcatgccactgaattaccagacagaattgacttcggatggggca
gggatttcaggtggtcaacgtcagagaatcgctttggcgcgtgctctcttgacagatgcg
ccggtcttgattttggatgaggcgactagcagtttggatattttgacagagaagcggatt
gtcgataatctcattgctttggacaagaccttgattttcattgctcaccgcttgactatt
gctgagcggacagagaaggtagttgtcttggatcagggcaagattgtcgaagaaggaaag
catgctgatttgcttgcacagggtggcttttacgcccatttggtcaatagctag

DBGET integrated database retrieval system