KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0929Help
Entry
SP_0929           CDS       T00057                                 

Gene name
rluD
Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Brite
KEGG Orthology (KO) [BR:spn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spn03009]
    SP_0929 (rluD)
Enzymes [BR:spn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SP_0929 (rluD)
Ribosome biogenesis [BR:spn03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SP_0929 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: AAK75053
UniProt: A0A0H2UPM0
Position
881298..882185
Genome map
AA seq 295 aa AA seqDB search
MEIKIETGGLRLDKALSDLSELSRSLANEQIKSGQVLVNGQVKKAKYTVQEGDVVTYHVP
EPEVLEYVAEDLPLEIVYQDEDVAVVNKPQGMVVHPSAGHTSGTLVNALMYHIKDLSGIN
GVLRPGIVHRIDKDTSGLLMIAKNDDAHLALAQELKDKKSLRKYWAIVHGNLPNDRGVIE
APIGRSEKDRKKQAVTAKGKPAVTRFHVLERFGDYSLVELQLETGRTHQIRVHMAYIGHP
VAGDEVYGPRKTLKGHGQFLHAKTLGFTHPRTGKTLEFKADIPEIFKETLERLRK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaattgaaactggtggtctgcgtttggataaggctttgtcagatttgtca
gaattatcacgtagtctcgcgaatgaacaaattaaatcaggccaggtcttggtcaatggt
caagtcaagaaagctaaatacacagtccaagagggtgatgtcgtcacttaccatgtgcca
gaaccagaggtattagagtatgtggctgaggatcttccgctagaaatagtctaccaagat
gaggatgtggctgtcgttaacaaacctcagggaatggttgtgcacccgagtgctggtcat
accagtggaaccctagtaaatgccctcatgtatcatattaaggacttgtcgggtatcaat
ggggttctgcgtccagggattgttcaccgtattgataaggatacgtcaggtcttctcatg
attgctaaaaacgatgatgcgcatctagcacttgcccaagaactcaaggataaaaagtct
ctccgcaaatattgggcgattgttcatggaaatctacctaatgatcgtggtgtaattgaa
gcgccgattggccggagtgaaaaagaccgtaagaaacaggctgtaactgctaaagggaag
cctgcagtgacgcgttttcacgtcttggaacgctttggcgattatagcttagtagagttg
caactggagacagggcgcactcatcaaatccgtgtccacatggcttatatcggccatcca
gtcgctggtgatgaggtctatggtcctcgcaagactttgaaaggacatggacaatttctt
catgccaagactttaggttttactcatccgagaacaggtaagaccttggaatttaaagca
gatatcccagagatttttaaggaaaccttggagagattgagaaagtaa

DBGET integrated database retrieval system