KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_0931Help
Entry
SP_0931           CDS       T00057                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
spn00330  Arginine and proline metabolism
spn00332  Carbapenem biosynthesis
spn01100  Metabolic pathways
spn01130  Biosynthesis of antibiotics
spn01230  Biosynthesis of amino acids
Module
spn_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:spn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SP_0931 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SP_0931 (proB)
Enzymes [BR:spn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SP_0931 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AAK75055
UniProt: Q97R95
Position
884172..885281
Genome map
AA seq 369 aa AA seqDB search
MKYKRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEAGHELILVSSGAIAAGFGALG
FKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQAL
SVLLNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQADLLVFLTDVDGLYTGNPNS
DPRAKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICSSLKSDS
MIEAAEETEDGSYFVAQEKGLRTQKQWLAFYAQSQGSIWVDKGAAEALSQYGKSLLLSGI
VEAEGVFSYGDIVTVFDKESGKSLGKGRVQFGASALEDMLRSQKAKGVLIYRDDWISITP
EIQLLFTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaacggattgtctttaaggtgggtacttcttctctgacaaatgaggatgga
agtttatcacgtagtaaggtaaaggatattacccagcagttggctatgctgcacgaggct
ggtcatgagttgattttggtgtcttcaggtgccattgcggctggttttggagccttagga
tttaaaaagcgtccgactaagattgctgataaacaggcttcagcagcggtagggcagggg
cttttgttggaagaatatacaaccaatcttctcttgcgtcaaatcgtttctgcacaaatc
ttgctgacccaagatgactttgtggataagcgtcgttataaaaatgcccatcaggctttg
tcggttttgctcaaccgtggggcaattcctatcatcaatgagaatgatagtgtcgttatt
gatgagctcaaggttggggacaatgacactctaagtgctcaagtagcggcgatggtccaa
gcagaccttttagttttcttgacagatgtggacggtctctatactggaaatcctaattca
gatccaagagccaaacgcttggagagaatcgagaccatcaatcgtgagattattgatatg
gctggtggagctggttcgtcaaacggaactgggggtatgttaaccaaaatcaaggctgca
actatcgcgacggaatcaggagttcctgtttatatctgctcatccttgaaatcagattcc
atgattgaggcggcagaggagaccgaggatggttcttactttgttgctcaagagaagggg
cttcgtacccagaaacaatggcttgccttctatgctcagagtcaaggttctatttgggtt
gataaaggggctgcggaagctctctctcaatatggaaagagtcttctcttatctggtatc
gttgaagcagaaggagtcttttcttacggtgatatcgtgacagtatttgacaaggaaagt
ggaaaatcacttggaaaaggacgcgtgcaatttggagcatctgctttggaggatatgttg
cgttctcaaaaagccaagggtgtcttgatttaccgtgacgactggatttccattactcct
gaaatccaactactttttacagaattttag

DBGET integrated database retrieval system